KEGG   Pyrenophora teres: PTT_14581Help
Entry
PTT_14581         CDS       T01613                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pte  Pyrenophora teres
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PTT_14581
   01230 Biosynthesis of amino acids
    PTT_14581
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTT_14581
   00030 Pentose phosphate pathway
    PTT_14581
   00051 Fructose and mannose metabolism
    PTT_14581
   00052 Galactose metabolism
    PTT_14581
  Energy metabolism
   00680 Methane metabolism
    PTT_14581
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PTT_14581
Enzymes [BR:pte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PTT_14581
Protein phosphatases and associated proteins [BR:pte01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PTT_14581
Messenger RNA biogenesis [BR:pte03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PTT_14581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 785 aa AA seqDB search
MAPTEIPPPLEGKKRRIGVMTSGGDAPGMNGAVRAVVRMAIHNNCEAFAIYEGYDGLVKG
GDMIKEMKWEDVRGFLSEGGTLIGTARCMEFMQREGRRRAAKNMIVKGIDALIICGGDGS
LTGADKFRAEWPELLNELVEAKELTAEQIEPFKHLNIVGLVGSIDNDLSMTDATIGCYTS
LGRICEAIDSVDTTAVSHQRAFVIEVMGRHCGWLALSAGVATGADFVFTPENPPAEGWQK
EMCRQIKKHRSLGKRKTIVVVAEGAIDRNLNKITSQQVKDILSEEAKLDTRVTTLGHVQR
GGTPCAYDRMLATLQGAEAVKAVLEATPDVPSPVICMQENKIVRRPLLEAVAQTKEVAVA
IENKDFHRAMQLRDTEFEQQYQAYQITTAADQPELLLPEDKRIRVGIIHVGAPAGGMNAA
TRAAVAYCLARGHKPIALHNGFPGIIRHHSDEPIGAVRDIDWVDAETWASKGGSEIGTNR
GLPSEDLETVAFVFKKYNIQSLFIVGGFEAFTAVSELRQAREYYKAFKIPMVIIPATISN
NVPGTEYSIGSDTCLNALIQYSDACRQSASASRRRVFIIETQGGESGYIATVAGLSIGAL
AVYTPEEGINLKMLDRDIDHLRAVFSKDKGVARSGKVILVNEKASKTYSVQIIAQMIAEA
SNGKFESRHGVPGHFQQGTTPSPMDRVRAVRFATKAMQHIETYAGMEPDEIADDPMSVSV
IGIKGSKLLFSPMETVEKKETEWHRRRPKHEFWMALKETVDTLSGRPQAPANPTPIDTLA
GRPAK
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaccgagattcccccgcccctcgagggcaagaagaggcgcattggagttatg
acgagcggaggagacgctcccggcatgaacggagcagtacgagccgtagtccgcatggcc
attcacaacaactgcgaggcgtttgccatatacgaaggctacgacggtctggtaaagggc
ggagacatgatcaaggagatgaagtgggaagacgtccgaggtttcctgtcggaaggaggc
acgctcatcggcacagcacgatgcatggagtttatgcagcgagagggtcgccgaagggcc
gcaaagaacatgattgtcaagggcattgacgcgctcatcatctgcggtggtgacggctct
ctcacaggtgcagacaagttccgcgctgagtggccggagctgctgaacgagctggtcgaa
gcaaaggagcttaccgctgagcaaattgaacccttcaagcacctcaacattgtcggtttg
gtcggctcaatcgacaatgatctttccatgactgatgccaccattggatgctacacatcg
ctcggacgcatctgcgaagccatcgactcggtcgacaccaccgccgtaagccatcagcga
gcattcgtcatcgaggtcatgggccgacactgtggttggcttgcgctcagtgctggtgtt
gcaacaggagccgactttgtcttcacacctgaaaaccctcctgccgaaggttggcaaaag
gaaatgtgtcgccagatcaagaagcacaggagtctgggcaagcgaaagaccatcgtcgtc
gttgccgagggcgctatcgaccgcaacctcaacaagatcacatcacaacaggtcaaggat
atcctttcggaagaagccaagcttgacacgcgagtgacgacgcttgggcacgttcagcgt
ggaggcacaccttgcgcatatgatcgtatgcttgcgacactccagggcgccgaggctgtc
aaggcggtactggaagctacgcctgacgttcccagcccagttatttgtatgcaagagaac
aagattgtccgtcgaccactccttgaagcagttgcacagaccaaagaagtcgctgttgct
atcgaaaacaaggacttccacagggctatgcagctccgcgacaccgagttcgagcaacag
taccaggcctatcagatcaccacagcggctgaccagccagaacttcttctcccagaagac
aagcgcatccgagttggtatcatccacgttggtgccccagctggaggtatgaacgcagcg
acccgtgctgccgtcgcatactgccttgctcgtggccacaagccaattgccctccacaac
ggtttccctggcataatccgccatcattccgatgagccgattggtgctgtgcgagacatt
gactgggttgacgctgagacgtgggcttccaagggtggatcggagattggaaccaaccgt
ggtcttcccagcgaggaccttgaaaccgttgcattcgtcttcaagaagtacaacatccag
tctttgttcatcgttggtggattcgaggctttcaccgctgtttccgaacttcgacaagca
cgggagtactacaaggcgttcaagattcccatggtcatcattcctgctaccatctctaac
aacgtccctggtacagagtactcaattggttcagatacttgcttgaacgcgttgatccag
tactccgacgcttgccgtcaatccgcatccgcgtctcgtcgccgagtgtttatcatcgaa
acccaaggtggcgagtctgggtacattgcaactgtggctggtctcagtatcggagcactg
gctgtgtacactcccgaagaaggcatcaacctcaagatgctcgaccgcgatatcgaccat
ctccgcgctgtcttttccaaggacaagggtgttgctcggtctggtaaagtgattctagtc
aacgagaaggcgtcaaaaacctactctgttcagatcattgcacagatgattgcggaagcc
tcgaatggcaagtttgagtctcgtcatggtgttcctggtcacttccaacaaggaacgacg
ccatcacccatggatcgtgtccgagccgttcgattcgccacaaaggccatgcagcacatt
gagacgtacgctggtatggaacccgatgaaatcgccgatgatccaatgtcagtcagcgtc
atcggtatcaagggctcgaagctactcttttcgcccatggaaacggtggagaagaaggag
actgagtggcaccgaagacgtcccaagcacgagttctggatggcgctcaaggagacggta
gatacgctttctggtagacctcaggccccagccaaccccacacctatcgatacgctggct
ggccgacctgcgaagtga

DBGET integrated database retrieval system