KEGG   Pyrenophora teres: PTT_14581Help
Entry
PTT_14581         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pte  Pyrenophora teres
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PTT_14581
   01230 Biosynthesis of amino acids
    PTT_14581
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTT_14581
   00030 Pentose phosphate pathway
    PTT_14581
   00051 Fructose and mannose metabolism
    PTT_14581
   00052 Galactose metabolism
    PTT_14581
  Energy metabolism
   00680 Methane metabolism
    PTT_14581
Enzymes [BR:pte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PTT_14581
Protein phosphatases and associated proteins [BR:pte01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PTT_14581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 785 aa AA seqDB search
MAPTEIPPPLEGKKRRIGVMTSGGDAPGMNGAVRAVVRMAIHNNCEAFAIYEGYDGLVKG
GDMIKEMKWEDVRGFLSEGGTLIGTARCMEFMQREGRRRAAKNMIVKGIDALIICGGDGS
LTGADKFRAEWPELLNELVEAKELTAEQIEPFKHLNIVGLVGSIDNDLSMTDATIGCYTS
LGRICEAIDSVDTTAVSHQRAFVIEVMGRHCGWLALSAGVATGADFVFTPENPPAEGWQK
EMCRQIKKHRSLGKRKTIVVVAEGAIDRNLNKITSQQVKDILSEEAKLDTRVTTLGHVQR
GGTPCAYDRMLATLQGAEAVKAVLEATPDVPSPVICMQENKIVRRPLLEAVAQTKEVAVA
IENKDFHRAMQLRDTEFEQQYQAYQITTAADQPELLLPEDKRIRVGIIHVGAPAGGMNAA
TRAAVAYCLARGHKPIALHNGFPGIIRHHSDEPIGAVRDIDWVDAETWASKGGSEIGTNR
GLPSEDLETVAFVFKKYNIQSLFIVGGFEAFTAVSELRQAREYYKAFKIPMVIIPATISN
NVPGTEYSIGSDTCLNALIQYSDACRQSASASRRRVFIIETQGGESGYIATVAGLSIGAL
AVYTPEEGINLKMLDRDIDHLRAVFSKDKGVARSGKVILVNEKASKTYSVQIIAQMIAEA
SNGKFESRHGVPGHFQQGTTPSPMDRVRAVRFATKAMQHIETYAGMEPDEIADDPMSVSV
IGIKGSKLLFSPMETVEKKETEWHRRRPKHEFWMALKETVDTLSGRPQAPANPTPIDTLA
GRPAK
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaccgagattcccccgcccctcgagggcaagaagaggcgcattggagttatg
acgagcggaggagacgctcccggcatgaacggagcagtacgagccgtagtccgcatggcc
attcacaacaactgcgaggcgtttgccatatacgaaggctacgacggtctggtaaagggc
ggagacatgatcaaggagatgaagtgggaagacgtccgaggtttcctgtcggaaggaggc
acgctcatcggcacagcacgatgcatggagtttatgcagcgagagggtcgccgaagggcc
gcaaagaacatgattgtcaagggcattgacgcgctcatcatctgcggtggtgacggctct
ctcacaggtgcagacaagttccgcgctgagtggccggagctgctgaacgagctggtcgaa
gcaaaggagcttaccgctgagcaaattgaacccttcaagcacctcaacattgtcggtttg
gtcggctcaatcgacaatgatctttccatgactgatgccaccattggatgctacacatcg
ctcggacgcatctgcgaagccatcgactcggtcgacaccaccgccgtaagccatcagcga
gcattcgtcatcgaggtcatgggccgacactgtggttggcttgcgctcagtgctggtgtt
gcaacaggagccgactttgtcttcacacctgaaaaccctcctgccgaaggttggcaaaag
gaaatgtgtcgccagatcaagaagcacaggagtctgggcaagcgaaagaccatcgtcgtc
gttgccgagggcgctatcgaccgcaacctcaacaagatcacatcacaacaggtcaaggat
atcctttcggaagaagccaagcttgacacgcgagtgacgacgcttgggcacgttcagcgt
ggaggcacaccttgcgcatatgatcgtatgcttgcgacactccagggcgccgaggctgtc
aaggcggtactggaagctacgcctgacgttcccagcccagttatttgtatgcaagagaac
aagattgtccgtcgaccactccttgaagcagttgcacagaccaaagaagtcgctgttgct
atcgaaaacaaggacttccacagggctatgcagctccgcgacaccgagttcgagcaacag
taccaggcctatcagatcaccacagcggctgaccagccagaacttcttctcccagaagac
aagcgcatccgagttggtatcatccacgttggtgccccagctggaggtatgaacgcagcg
acccgtgctgccgtcgcatactgccttgctcgtggccacaagccaattgccctccacaac
ggtttccctggcataatccgccatcattccgatgagccgattggtgctgtgcgagacatt
gactgggttgacgctgagacgtgggcttccaagggtggatcggagattggaaccaaccgt
ggtcttcccagcgaggaccttgaaaccgttgcattcgtcttcaagaagtacaacatccag
tctttgttcatcgttggtggattcgaggctttcaccgctgtttccgaacttcgacaagca
cgggagtactacaaggcgttcaagattcccatggtcatcattcctgctaccatctctaac
aacgtccctggtacagagtactcaattggttcagatacttgcttgaacgcgttgatccag
tactccgacgcttgccgtcaatccgcatccgcgtctcgtcgccgagtgtttatcatcgaa
acccaaggtggcgagtctgggtacattgcaactgtggctggtctcagtatcggagcactg
gctgtgtacactcccgaagaaggcatcaacctcaagatgctcgaccgcgatatcgaccat
ctccgcgctgtcttttccaaggacaagggtgttgctcggtctggtaaagtgattctagtc
aacgagaaggcgtcaaaaacctactctgttcagatcattgcacagatgattgcggaagcc
tcgaatggcaagtttgagtctcgtcatggtgttcctggtcacttccaacaaggaacgacg
ccatcacccatggatcgtgtccgagccgttcgattcgccacaaaggccatgcagcacatt
gagacgtacgctggtatggaacccgatgaaatcgccgatgatccaatgtcagtcagcgtc
atcggtatcaagggctcgaagctactcttttcgcccatggaaacggtggagaagaaggag
actgagtggcaccgaagacgtcccaagcacgagttctggatggcgctcaaggagacggta
gatacgctttctggtagacctcaggccccagccaaccccacacctatcgatacgctggct
ggccgacctgcgaagtga

DBGET integrated database retrieval system