KEGG   Pyrenophora teres: PTT_14588Help
Entry
PTT_14588         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pte  Pyrenophora teres
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pte00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pte00312]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 934 aa AA seqDB search
MGKAEKMDPVWDDLDRTMGQLFMMGFDGTSVTPHIRTLIEEHHVGCILLTAKNLKSAEDT
TKLIYELQKIAHDAGHPVPLAIGIDQENGGVNSLFDDIYIRQYPSNMGMAATGSTDLAFE
VAKSTAQEIAACGINWIFGPCLDVLTNARNQPLGVRTAGDDPQEVSAFGVAFMQGYKDAG
VVTLGKHFPSYGNLEFLGSTLDVPIITESLEQLSLSALIPFKRAIEKGLDSMMVGGCAMS
SAGLNAMHACLSEQVVDELLRKDLNFDGVVVSECLEMDALSHNIGVGGGTVMAVNAGCDV
VLLCRSFSLQQEGLKGLKTGIEGEMVSKERIFNSLRRVLAMKKKCTSWEKALNPPGINYL
EKLQPSHTALSTKAYNSSITVVRDKNRLLPLTNILESEEELLLLTPLVKPLAASAASRAI
SDAANGAASHSPEPASWDRSSSVMSGERVFRELGRSLARQRNGRLLHTSYTANGVRPVHE
SLISRASAIIVLTADANRNLYQHGFTKHVSMICNTQYTAGGERREKPLIVVAVSSPYDFA
MDTSIGTYICTYDFTETALNSLVRVLYGEMSPSGTLPGTISKSQKLHPSKQHWLVEIFNE
ERDGVALDTLVTAVVESTSPNQRSELSSATSSSFILHHPEVEESHFVVRNSSTQALYGFC
STYFFKATGTGVIGALFVDPARRKLSIGHSLHNRAIRTLLQKEGVKRFQLGSRLPSMYLG
IPTGHGNERKRLRSWFAQLGWGAALSRPVCNMVARNLQTWSPPPGMAKSLASAGAQFDLV
YGWDYAGPILDHIKTSNRQGLAEVYKLALSDPTACGIIRAKRPEDGALVGTVVLYNSHSR
LAEYIPPLKDLNEAAGGISSPVISPGVGEYSTLLQGLILLGMRQIKQLGCNACLLDYMDG
DGNFDGFSAMGFDVMHNFEEVSCDAATWTMIPPA
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagccgagaaaatggacccggtatgggacgatctcgataggactatgggccaa
ctgttcatgatgggcttcgatggcacgtcggttactccacacatccgcacgctcatcgag
gaacaccacgttggctgcatactgctcactgccaagaacttaaaatccgccgaagacacg
accaagctcatttatgagctgcagaagattgctcatgacgccggccatccggttccgctg
gcgattggcatcgatcaggagaacggcggtgtgaatagtcttttcgatgacatctacatt
cgacagtaccctagcaacatgggcatggcggcaacaggctcgaccgacctagcattcgaa
gtagcaaaatcgactgcgcaagagattgctgcctgtggtatcaactggatctttggcccg
tgtttggatgtactcaccaatgcaagaaaccagccactaggcgtgagaacggctggcgat
gatccccaggaagtgtctgcctttggtgtcgcattcatgcagggctacaaagatgccgga
gtggtgactttgggcaagcacttcccctcgtatggcaacctagagtttctgggctcgaca
cttgatgtgcccatcatcacagagtctctggagcagttgagtctaagcgccctgattcct
ttcaagagggcgattgaaaaaggtcttgactcgatgatggttggcggatgtgccatgtca
tcagctggactgaacgccatgcatgcttgcctgtctgagcaggttgttgacgagctactt
cgaaaagacctaaactttgacggtgtggtcgtttccgagtgtctggagatggatgcgctc
agtcacaacattggcgtaggtggtggcactgtcatggcagtgaatgctggctgcgatgtc
gtgcttctttgccgttccttctcactgcaacaggaggggctaaaaggcctcaagactggg
atcgaaggtgaaatggtgtcgaaagagcgcatcttcaactcacttaggcgcgtcttggcc
atgaagaagaagtgtacgtcttgggagaaggcattaaatcctcctggaatcaactacctc
gagaagctccagccttcccatactgccctttcaacaaaagcgtacaacagctccatcaca
gtcgtgcgcgataagaacaggctcctaccgctgacgaacatactcgaaagtgaagaggag
cttcttctgctgacgcccttggtcaagccgctggctgcatcagctgcatcacgagccata
tctgacgctgctaacggcgccgccagtcactcaccagaacccgcgtcttgggaccgtagt
tcgtcggttatgagtggagagcgcgtgtttagggagctgggtcgatctctggctagacag
cgcaatgggcggttgctgcatacatcatacacggccaacggtgttcgacctgtgcacgag
agtctcatcagcagagcgagtgccatcatcgtcctcacagcagacgccaaccggaatctc
taccagcacggcttcaccaagcatgtgtccatgatatgcaatacacaatacacagccggt
ggcgagagacgtgagaagcctctgattgtggttgcagtcagctcaccgtacgactttgcc
atggacaccagcatcgggacgtacatatgcacgtacgactttacggaaactgcactgaat
tccttggtgagagtactatacggggaaatgtcgccttctggtactttgccgggcaccatc
agcaagagccagaaactacatccgtcgaagcaacactggctggttgagatcttcaacgaa
gaaagagatggggttgctctggacacattggtcacggcggttgtggagagtacgtcgccg
aatcagagatcagagttgtcgagcgcgacgtcgagttcattcattctccatcatcccgaa
gtggaagagtcgcattttgtggtcaggaacagcagcacgcaagcactttatggcttctgc
tcgacatacttcttcaaagccacgggcactggtgttatcggagcactgtttgtggacccg
gcgaggagaaagctctccatcggacactctctgcacaaccgggcgattcggactctactg
cagaaagaaggcgtcaaacgcttccaattgggatcgcgcctgccaagcatgtatctcggt
atcccgaccggacacggcaacgagcggaaacggttgcggtcatggtttgctcagctcggg
tggggagctgcactttcccgtcctgtgtgcaacatggtagcgcgtaatctgcagacgtgg
tctccaccccctggcatggccaagagcctggcaagcgcaggtgcacagtttgacctcgta
tacggatgggactacgcaggaccgatactcgaccacatcaaaaccagcaatcggcaggga
ctggcagaggtgtacaagcttgcactcagcgatcccacggcgtgtggaatcatacgggcg
aagcgaccagaggatggggcgttggtgggtacggtggtgctgtacaacagccactcacgt
ctggccgaatacatacctccgctgaaggatttgaacgaggcagccggaggtatctcgtcg
cctgtcatctcacctggggttggcgagtactcgacactactgcaggggttgatcctcctc
ggcatgcggcagatcaagcagctagggtgcaatgcctgcttgttggattatatggatgga
gatggcaactttgacggcttctcggccatgggattcgacgtcatgcacaactttgaggag
gtgagctgtgacgcggccacatggaccatgatcccgccggcgtga

DBGET integrated database retrieval system