KEGG   Pyrenophora teres: PTT_14692Help
Entry
PTT_14692         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pte  Pyrenophora teres
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pte00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 308 aa AA seqDB search
MAETSRGKTPVLLLKTKSVPTDTYEELFLTLDNGHYAPVFVPVLEHRFKQDALSEVRHHV
TSRGFVPQSQQGLAIYGALVFTSQRAVEAFSAVVEEIRKQGAVDIDDLLPESLPLYVVGP
ATARGLRSLGLKCPILGEETGNGEALAGFILRHYNAMHPDTPNPPVLFMVGDKRRDIIPK
TLQAPELEPNTRARVDELVIYETGEMQSFKQDFTATWRNNAEQGSNHQWVVVFSPSGCKA
MLESLGLLDPETGRTKSATDPRDILIATIGPTTRDYLVQEFGFTPDVCAEKPSPEGIAEG
IRAFIEKH
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcagagacatcgcggggcaagacgccggttttgctcttgaagacaaagtcagtgcca
acggatacctacgaagagctgttcctcactctcgacaacggccactatgcacctgtcttt
gtgcctgtcttggagcacaggttcaagcaagatgccctgagtgaggtgcgccaccatgta
accagccgaggcttcgtcccacaatcccaacagggccttgcgatatatggtgctctggtc
tttacttcgcaacgcgctgtcgaagccttcagtgccgtcgtcgaggagatccggaagcaa
ggagccgttgacattgatgacctccttccagagagcctgccgctgtatgtcgtcggtccc
gccacagcgcgcggtctgcggtcgctggggctcaaatgtccgatcctgggcgaggaaacc
ggtaatggcgaagccctggccggctttatcttgagacattataacgccatgcacccggat
actccgaacccgcctgtactgttcatggttggcgacaagaggagggacataataccgaag
actctacaggcaccagagctggagcccaacacgagagccagagtggacgaactggtgata
tacgagactggagagatgcaatctttcaagcaagactttacagccacctggcgcaacaac
gcagaacaaggctcaaatcaccaatgggttgttgtgttttcgccaagtgggtgtaaagcg
atgctggagagtctgggtcttttagatccagagacagggcgcacgaaatctgctactgat
ccgagagacatcctgatagcgaccatcggaccgactacccgtgactacctggtacaagaa
ttcggcttcactccagatgtgtgtgctgagaagccaagccccgagggtatagcagaaggc
atcagagcctttatcgaaaagcattag

DBGET integrated database retrieval system