KEGG   Pyrenophora teres: PTT_14847Help
Entry
PTT_14847         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pte  Pyrenophora teres
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 352 aa AA seqDB search
MPPAGSGSSRKISFNVSEQYDIQDVVGEGAYGVVCSALHKPSGQKVAIKKITPFDHSMFC
LRTLREMKLLRYFNHENIISILDIQKPRNYETFTEVYLIQELMETDMHRVIRTQELSDDH
CQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASTEDNSGFMT
EYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDVLG
TPTMEDYYGIKSRRAREYIRSLPFKKKIPWKAMFPKTNDLALDLLERLLAFNPVKRITVE
EALKHPYLEPYHDPDDEPTADPIPEEFFDFDKNKDNLTKEQLKLLIYQEIMR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgccacccgcagggagcggcagctccaggaagatctccttcaatgtctccgagcagtac
gatatccaggatgtcgtgggagaaggcgcgtacggtgttgtctgctccgcgcttcacaag
ccgtcaggccaaaaggtcgccatcaagaagatcacaccctttgatcactctatgttctgt
ctgagaacactacgagagatgaagctactgcgctacttcaaccacgagaacatcatctcc
attctcgacatccagaagccgaggaactacgagacctttactgaggtttatctgattcag
gaactcatggagacagacatgcatcgcgtcatccgcacacaggagctatccgacgaccat
tgccagtactttatctaccaaaccctgcgcgcactgaaggcgatgcactcggcgaacgta
ctccaccgagatctcaagccctccaacttgctcctaaacgcaaactgcgatctcaaagtc
tgcgatttcggtctggctcgatcggccgcttcgaccgaagacaactctggattcatgacg
gaatacgttgccacgcgatggtaccgtgcaccggagatcatgcttacgttcaaggagtac
acaaaggccatcgacgtctggagtgtaggatgtattctagctgagatgctcagcgggaag
cccttgttcccaggaaaggactaccaccaccagctcactttgattcttgatgtgctcggc
acgccgaccatggaggactactacggaatcaagtcccgccgagctcgcgagtacatccga
tctctgcccttcaagaagaagatcccatggaaggccatgttccccaagaccaacgatctg
gcgcttgacctgctcgagcggttacttgctttcaaccccgtgaagcgaatcacggtcgag
gaagcgctcaagcacccataccttgagccataccatgacccagatgacgagccaaccgcc
gacccaattccagaggagttcttcgacttcgataaaaacaaggacaacctgacaaaggag
cagctgaagctactcatctaccaggagatcatgcgataa

DBGET integrated database retrieval system