KEGG   Pyrenophora teres: PTT_15080Help
Entry
PTT_15080         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pte  Pyrenophora teres
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PTT_15080
   00670 One carbon pool by folate
    PTT_15080
Enzymes [BR:pte01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PTT_15080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 197 aa AA seqDB search
MPPKSPTLTLILAATPNLGIGNAGGLPWPQLKKEMGFFARVTKRTSPPSNNGTKKINAVL
MGRKTWESIPPKFRPLKDRLNIVITSKPEEFAKKLDKKNAEDVTEGPMVCSGILDALSQL
ERLQAKKTSSSPSSPDLELDKIFEFECDTFFPINLEETTFWKGRSREEVQEFTGEEVPEG
GLEEQGVGFEFCMYERE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgccacccaagtccccaacactcaccctcatcctcgccgccacgccaaacctcggcatt
ggaaacgctggaggtctaccctggccccagctcaaaaaggaaatgggtttcttcgctcgg
gtaacaaagcgtacatcaccaccaagtaacaacggcacaaagaagatcaacgccgtgctc
atgggccgcaagacatgggagagcataccgcccaaattccgcccgctaaaagaccgctta
aacatcgtcattacatcaaagcccgaggaattcgcaaaaaaactagacaagaagaacgca
gaagatgtcaccgagggacccatggtttgctctggtatcctagacgcactatcgcaactt
gagcgtcttcaagccaagaagacttcttcatcaccatcatctcccgatcttgaactcgac
aaaatcttcgagtttgagtgcgatactttctttcctattaatctcgaggagactacgttt
tggaaagggagaagtagggaagaggttcaggagtttaccggtgaggaggtaccagagggg
gggttggaggaacagggggttggatttgagttttgtatgtatgagagagagtag

DBGET integrated database retrieval system