KEGG   Pyrenophora teres: PTT_15080Help
Entry
PTT_15080         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pte  Pyrenophora teres
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pte00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pte00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 197 aa AA seqDB search
MPPKSPTLTLILAATPNLGIGNAGGLPWPQLKKEMGFFARVTKRTSPPSNNGTKKINAVL
MGRKTWESIPPKFRPLKDRLNIVITSKPEEFAKKLDKKNAEDVTEGPMVCSGILDALSQL
ERLQAKKTSSSPSSPDLELDKIFEFECDTFFPINLEETTFWKGRSREEVQEFTGEEVPEG
GLEEQGVGFEFCMYERE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgccacccaagtccccaacactcaccctcatcctcgccgccacgccaaacctcggcatt
ggaaacgctggaggtctaccctggccccagctcaaaaaggaaatgggtttcttcgctcgg
gtaacaaagcgtacatcaccaccaagtaacaacggcacaaagaagatcaacgccgtgctc
atgggccgcaagacatgggagagcataccgcccaaattccgcccgctaaaagaccgctta
aacatcgtcattacatcaaagcccgaggaattcgcaaaaaaactagacaagaagaacgca
gaagatgtcaccgagggacccatggtttgctctggtatcctagacgcactatcgcaactt
gagcgtcttcaagccaagaagacttcttcatcaccatcatctcccgatcttgaactcgac
aaaatcttcgagtttgagtgcgatactttctttcctattaatctcgaggagactacgttt
tggaaagggagaagtagggaagaggttcaggagtttaccggtgaggaggtaccagagggg
gggttggaggaacagggggttggatttgagttttgtatgtatgagagagagtag

DBGET integrated database retrieval system