KEGG   Pyrenophora teres: PTT_15086Help
Entry
PTT_15086         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pte  Pyrenophora teres
Pathway
pte00010  Glycolysis / Gluconeogenesis
pte00071  Fatty acid degradation
pte00350  Tyrosine metabolism
pte01100  Metabolic pathways
pte01110  Biosynthesis of secondary metabolites
pte01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTT_15086
  Lipid metabolism
   00071 Fatty acid degradation
    PTT_15086
  Amino acid metabolism
   00350 Tyrosine metabolism
    PTT_15086
Enzymes [BR:pte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PTT_15086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: EFQ88853
UniProt: E3RZK1
Position
Unknown
AA seq 366 aa AA seqDB search
MADTKVQTFDIPKTCKGGVVVNEGPDFHVEVQDLPVPECGPTDVLIKLNATGICHSDLHF
MINDWAMPKMSDLGTRCAGHEGAGVIVKVGEHVKTLKPGMRAGYKPIQDTCGACQNCRDG
NECYCQKAVITGLMVDGSYKQYVVSPERYTTLIPDGVNDFVAGPIMCSAATIYTSLKESG
LQPGDWAVFPGAGGGVGLQGVQLASAMGLRPVAIDTGAEKEKLCMEVGRAEHFIDFKQFE
NVAEEVIRTCGGIGAHGVFVSAVQSYPSSLSYLGKRVGGKVMCIGLPPAGTQHIDVDPNQ
MCFFKQSVHGTLVSSMADVDKTLDFARRGLLRPIYTVYPLSQFNEAVQKLRRGEIAGRAV
VDFNQE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcagacactaaagtccagacctttgacatcccgaaaacatgcaaaggcggcgttgtt
gtgaacgaaggcccagactttcatgttgaagtacaagacctcccagtgccagagtgtgga
cccacggatgtccttatcaagctcaatgcgacgggcatatgccactcagatcttcacttt
atgatcaacgactgggccatgccaaagatgtctgatctgggcacaagatgcgctggacac
gaaggcgcaggagtcatcgtcaaagtcggagagcatgttaaaaccctgaagcctggtatg
cgggccggatacaagcccatccaggatacttgcggggcttgtcaaaattgccgcgacgga
aatgaatgttactgccaaaaggccgtcattaccggactcatggttgacggctcgtacaag
caatacgttgtctcgcccgagcgatacaccaccctgattccagacggcgtgaacgacttt
gttgcagggcccatcatgtgctctgctgctacgatatatacttcactcaaagaatccgga
ctacaacccggtgactgggccgttttccctggcgcggggggtggtgttggccttcaggga
gtccagttggcctcggccatgggtctccgccccgtagcaattgacactggggctgagaag
gaaaagctttgcatggaagtaggacgcgcggagcacttcatcgactttaaacaattcgaa
aatgtcgccgaggaagtaatacgaacgtgcggcgggattggcgcgcatggcgtctttgtc
tctgctgtgcagtcatacccgtcttcgttatcgtatctgggcaaacgagttggtggaaag
gtcatgtgcatcggcctgccgccagctggtactcaacacatcgatgttgacccgaaccaa
atgtgcttcttcaagcagagcgtacacggcacgcttgtgagcagcatggcagatgtggat
aagacgcttgatttcgcgcgccgcggacttctccgaccaatctacaccgtctatcctttg
agccagttcaacgaagcggtgcagaagctgaggcgcggggagattgctggcagggctgta
gtcgatttcaaccaggagtaa

DBGET integrated database retrieval system