KEGG   Pyrenophora teres: PTT_15101Help
Entry
PTT_15101         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
pte  Pyrenophora teres
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PTT_15101
Enzymes [BR:pte01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     PTT_15101
Glycosyltransferases [BR:pte01003]
 Polysaccharide
  Storage polysaccharide
   PTT_15101
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 705 aa AA seqDB search
MAETGARDVQNHCLFEVATEVANRVGGIYSVLKSKAQVTTAEYGAAYTLLGPWNRASAAV
EVEPIEPKDPALVATIKSMDDRGIKTLYGRWLIDGAPRVLLFDTGTGYRWLDEWKGDLWS
STGIPSPPGDSETNEAIVFGYLIAWFLGEYVYHEKKRAVIVQFHEWLAGVAVPLCKKRRI
DVTTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDAEAGKRGIYHRYCIERAATHAADVFT
TVSHITAYESEHLLKRKPDGVLPNGLNVKKFSATHEFQNLHQQAKVKINDFVRGHFYGHN
DFDPENTLYFFTAGRYEYRNKGVDMFIESLARLNHKMKNENSNMTVVAFIILPAQTTSLS
VDSLKGQAVIKALHDSVNNIAENVAKKLFERSLTWTEGSELPEDKDLITPADKILLRRRL
FAMKRHNLPPIVTHNMVNDAEDPVLNQLRRCQLFNHPSDRVKVVFHPEFLNSANPVLPMD
YDDFVRGTHLGVFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENAQDYGIYI
VDRRMKGVDDSVNQLVDYMYDFTKKSKRQRINQRNRTERLSDLLDWKRMGLEYVKARQLA
LRRAYPAAYEDDDEPDFFSSQDVKISRPLSEPGSPRDRSGMMTPGDFASLQEGREGLSTE
DYIAWKLPEEEEADDFTFPLTLKTKSKPNSGANTPTLPAAVNGTD
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaccggagcaagagacgtacagaatcattgcctgttcgaggtagcgactgag
gtcgcaaacagagtcggcggtatctactcggttctcaagtcaaaggcccaggtcactaca
gcagagtatggcgccgcatatactctcctgggtccctggaacagggcttcggccgctgtc
gaagtagagcccattgagccaaaggaccctgctttggtagctaccatcaagtccatggac
gaccgtggcatcaagacgctgtacggaagatggctgattgacggtgccccgcgcgtgctc
ctctttgacactggtaccggttaccgctggctcgacgagtggaagggtgacctttggtcc
tctacgggcattccttccccacctggcgattccgagaccaacgaggccattgtatttggc
tacctcatcgcctggtttttgggagagtatgtctaccacgagaagaagcgagctgtcatt
gtccagttccacgagtggctcgcaggcgtcgcagtccctctgtgcaagaagcgccgcatt
gatgtgaccaccatcttcaccacccacgctacgctgctgggccgttacctctgcgccggc
tcagtcgatttctacaacaacctccaatacttcgacgtggacgctgaggcaggaaagcgt
ggtatctaccacaggtactgcatcgagcgagccgctacccacgctgccgatgtctttact
accgtctctcacatcaccgcatacgagagcgagcatctcttgaagcgaaagcccgacggc
gtcttgcccaacggtttgaacgtcaagaagttctcggccacgcacgagttccagaacctc
catcagcaggccaaggtcaagattaacgactttgtccgtggtcatttctacgggcacaac
gattttgacccagagaacaccctctacttcttcaccgctggtcgctacgagtacaggaat
aagggtgtggacatgttcattgaatcgttggcacgactcaaccacaagatgaagaacgag
aactccaacatgacggttgttgccttcatcattctgcctgcgcagacgacctctctatcg
gtcgactcgctcaagggccaggctgttatcaaggcactacacgacagtgttaacaacatc
gccgagaacgtagccaagaagctcttcgagcgatccttgacatggacagagggctcagaa
ctgccagaagacaaggacttgatcactcctgccgacaagatcctgcttcgccgtcggttg
tttgccatgaagcgccacaacctcccgcccatcgtcacccacaacatggtcaatgatgcc
gaagacccggtgctgaaccagctccgtcgctgccagctgttcaaccacccgtccgaccgt
gtcaaggttgtgttccaccctgagttcttgaactcggccaaccctgtcttgcccatggac
tacgatgactttgtacgcggaacccatcttggtgtcttctcatcatactacgagccctgg
ggttacactccagctgagtgcaccgtaatgggtgttcccagtatcaccaccaacctttcc
gggtttggttgctacatggaggagttgattgagaatgcccaggactacggtatctacatt
gtggaccgaaggatgaagggtgtggacgattccgtaaaccagctcgtcgactacatgtac
gacttcaccaagaagagcaagcgacagcgcatcaatcagcgtaaccgaaccgagcgcctc
agcgatctgctcgactggaagcgcatgggcttggagtatgtcaaggcccgacaattggcc
ctccgacgagcataccctgcagcatacgaagacgacgacgagcccgacttcttcagctcg
caagatgtcaagatctcgcggccactgtctgagcctgggtctccccgcgaccgctcaggc
atgatgacgcctggtgactttgcttcgctgcaggaaggccgtgagggactgagcaccgag
gactacattgcgtggaagctccctgaagaagaagaggctgacgactttaccttcccgctc
actctgaagacgaagagtaagcctaattcaggcgcaaacacccctacattgcccgctgcg
gtaaatggcactgactaa

DBGET integrated database retrieval system