KEGG   Pyrenophora teres: PTT_15242Help
Entry
PTT_15242         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pte  Pyrenophora teres
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:pte01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pte00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 600 aa AA seqDB search
MLRNISRSVARQSRSSRIANRAPQFLRPLSTSVCRMSSSTLKAVEPPVSAALPGDSFQLL
PEAAKAGQAEDALFEEQVQAVKDWWASPRYKGIKRPYSAEDVVSKRGSLQQSYPSSLMAR
KLFNLLEERAAKGEPVHTMGAIDPIQMSQQAANQEVLYVSGWACSSVLTTTNEVSADFGD
YPYNTVPNQVQRLFKAQQLHDRKNWDNRRKMSAEERAKTPYLDYMRPIIADGDTGHGGLS
AVIKLAKLFAENGAAGVHFEDQLHGGKKCGHLAGKVLVPVGDHINRLVAARFQWDMMGCE
NLVIARTDSESGKLISSAVDVRDHEFIKGVTEDTEPLAETLQNMEAAGAPGKEIDQYEAA
WVKKHKLVTFDEAVVQHLEKESASQSTIDSYLAEVKQNPDYSLLKRRNVAEKYTKTPVYF
NWDVPRTREGFYHYKAGVAAATKRGKEYAPYADLLWVETGDPNVQEAAKFAGEIRAVHPG
KKFVYNLSPSFNWMGQGFSEEALKSFVWDLAKHGFVFQLISLAGIHSTATITCELSRAFK
DEGMLAYVKLVQSREKELGCDVLTHQKWSGAGYIDGILGAIQSGSSGSKSMGEGNTETGF
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcaatatatcacgttcagttgcgcgacagagcaggtcatcaagaatagcgaac
cgagcaccacaattcctccgcccgctctccacgtccgtatgtcgcatgtcgagctcgacg
ctcaaagctgtagaacccccagtatcggcagctctacccggcgattcgtttcaactactt
cctgaagctgccaaagcaggtcaggcggaagatgcgctcttcgaggagcaggtacaagcc
gtgaaggactggtgggcctcgccacggtacaagggtatcaagaggccatactctgcagaa
gatgttgtgagcaagcgaggatctctccaacaatcgtaccctagctcgttaatggcacgg
aaactcttcaacctactcgaagagagggcagcaaagggcgagccagtacacaccatgggt
gcaattgaccctatccaaatgtctcagcaggctgcaaaccaggaggtcctttacgtctct
ggttgggcttgctcttccgtcctgactaccacaaacgaagtctcagccgactttggcgat
tatccctacaataccgtgcccaaccaagtgcaacgtctcttcaaggctcagcaactacat
gatcgcaagaactgggacaacaggaggaagatgagtgcagaggaaagggcgaagacgccc
tacttggattacatgcgacccatcattgctgatggcgacactggccatggaggtctatcc
gcagtcatcaaactggcaaagctcttcgcagagaacggagccgcaggtgttcacttcgag
gaccaactccatggcggcaagaagtgcggacatctcgcaggaaaagtgctcgtaccagtc
ggagaccacatcaaccgcctcgtagctgcaagatttcaatgggacatgatgggctgtgaa
aacctagtcattgcacgcactgattcggagagcggcaaactcatttccagcgccgtcgac
gtgcgggatcacgagtttatcaaaggcgtcacagaagacactgaaccgttggccgagaca
ctacagaacatggaagcagcaggtgcgccaggaaaggaaattgaccagtatgaggcagca
tgggtgaagaagcacaagctcgttacctttgacgaggccgtcgtccaacacctcgagaag
gaaagtgcatctcaatcaacaatcgactcataccttgcagaagtcaagcagaaccccgac
tactcccttctcaagcggcggaacgtggcagagaagtacaccaagacgccagtctacttc
aactgggacgttccacgcacaagagagggtttctaccactacaaagctggcgttgcagca
gcgacaaagcgtggcaaagaatatgctccttacgctgacctgctctgggtcgagacgggc
gaccccaacgtccaagaagccgccaaattcgccggcgaaatccgcgctgtccatcccggc
aagaagtttgtatacaacctctctccaagtttcaactggatgggccaaggcttctccgag
gaagctctcaagtcattcgtctgggatctggcgaaacatggcttcgtcttccagctcatc
tcgctggcgggcatacactctactgccacaattacatgtgagctaagcagggctttcaag
gacgagggtatgttggcgtatgtcaagttggtgcagtcgagggagaaggagttgggctgc
gatgtcctgacgcatcagaagtggagcggtgctgggtacattgacggcatcttgggcgcg
atacaaagcggaagttcaggaagcaaaagtatgggtgagggcaacacagaaacgggtttc
taa

DBGET integrated database retrieval system