KEGG   Pyrenophora teres: PTT_15242Help
Entry
PTT_15242         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pte  Pyrenophora teres
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PTT_15242
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PTT_15242
Enzymes [BR:pte01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PTT_15242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 600 aa AA seqDB search
MLRNISRSVARQSRSSRIANRAPQFLRPLSTSVCRMSSSTLKAVEPPVSAALPGDSFQLL
PEAAKAGQAEDALFEEQVQAVKDWWASPRYKGIKRPYSAEDVVSKRGSLQQSYPSSLMAR
KLFNLLEERAAKGEPVHTMGAIDPIQMSQQAANQEVLYVSGWACSSVLTTTNEVSADFGD
YPYNTVPNQVQRLFKAQQLHDRKNWDNRRKMSAEERAKTPYLDYMRPIIADGDTGHGGLS
AVIKLAKLFAENGAAGVHFEDQLHGGKKCGHLAGKVLVPVGDHINRLVAARFQWDMMGCE
NLVIARTDSESGKLISSAVDVRDHEFIKGVTEDTEPLAETLQNMEAAGAPGKEIDQYEAA
WVKKHKLVTFDEAVVQHLEKESASQSTIDSYLAEVKQNPDYSLLKRRNVAEKYTKTPVYF
NWDVPRTREGFYHYKAGVAAATKRGKEYAPYADLLWVETGDPNVQEAAKFAGEIRAVHPG
KKFVYNLSPSFNWMGQGFSEEALKSFVWDLAKHGFVFQLISLAGIHSTATITCELSRAFK
DEGMLAYVKLVQSREKELGCDVLTHQKWSGAGYIDGILGAIQSGSSGSKSMGEGNTETGF
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcaatatatcacgttcagttgcgcgacagagcaggtcatcaagaatagcgaac
cgagcaccacaattcctccgcccgctctccacgtccgtatgtcgcatgtcgagctcgacg
ctcaaagctgtagaacccccagtatcggcagctctacccggcgattcgtttcaactactt
cctgaagctgccaaagcaggtcaggcggaagatgcgctcttcgaggagcaggtacaagcc
gtgaaggactggtgggcctcgccacggtacaagggtatcaagaggccatactctgcagaa
gatgttgtgagcaagcgaggatctctccaacaatcgtaccctagctcgttaatggcacgg
aaactcttcaacctactcgaagagagggcagcaaagggcgagccagtacacaccatgggt
gcaattgaccctatccaaatgtctcagcaggctgcaaaccaggaggtcctttacgtctct
ggttgggcttgctcttccgtcctgactaccacaaacgaagtctcagccgactttggcgat
tatccctacaataccgtgcccaaccaagtgcaacgtctcttcaaggctcagcaactacat
gatcgcaagaactgggacaacaggaggaagatgagtgcagaggaaagggcgaagacgccc
tacttggattacatgcgacccatcattgctgatggcgacactggccatggaggtctatcc
gcagtcatcaaactggcaaagctcttcgcagagaacggagccgcaggtgttcacttcgag
gaccaactccatggcggcaagaagtgcggacatctcgcaggaaaagtgctcgtaccagtc
ggagaccacatcaaccgcctcgtagctgcaagatttcaatgggacatgatgggctgtgaa
aacctagtcattgcacgcactgattcggagagcggcaaactcatttccagcgccgtcgac
gtgcgggatcacgagtttatcaaaggcgtcacagaagacactgaaccgttggccgagaca
ctacagaacatggaagcagcaggtgcgccaggaaaggaaattgaccagtatgaggcagca
tgggtgaagaagcacaagctcgttacctttgacgaggccgtcgtccaacacctcgagaag
gaaagtgcatctcaatcaacaatcgactcataccttgcagaagtcaagcagaaccccgac
tactcccttctcaagcggcggaacgtggcagagaagtacaccaagacgccagtctacttc
aactgggacgttccacgcacaagagagggtttctaccactacaaagctggcgttgcagca
gcgacaaagcgtggcaaagaatatgctccttacgctgacctgctctgggtcgagacgggc
gaccccaacgtccaagaagccgccaaattcgccggcgaaatccgcgctgtccatcccggc
aagaagtttgtatacaacctctctccaagtttcaactggatgggccaaggcttctccgag
gaagctctcaagtcattcgtctgggatctggcgaaacatggcttcgtcttccagctcatc
tcgctggcgggcatacactctactgccacaattacatgtgagctaagcagggctttcaag
gacgagggtatgttggcgtatgtcaagttggtgcagtcgagggagaaggagttgggctgc
gatgtcctgacgcatcagaagtggagcggtgctgggtacattgacggcatcttgggcgcg
atacaaagcggaagttcaggaagcaaaagtatgggtgagggcaacacagaaacgggtttc
taa

DBGET integrated database retrieval system