KEGG   Pyrenophora teres: PTT_15400Help
Entry
PTT_15400         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pte  Pyrenophora teres
Pathway
pte00010  Glycolysis / Gluconeogenesis
pte00051  Fructose and mannose metabolism
pte00562  Inositol phosphate metabolism
pte01100  Metabolic pathways
pte01110  Biosynthesis of secondary metabolites
pte01130  Biosynthesis of antibiotics
pte01200  Carbon metabolism
pte01230  Biosynthesis of amino acids
Module
pte_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pte_M00002  Glycolysis, core module involving three-carbon compounds
pte_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTT_15400
   00051 Fructose and mannose metabolism
    PTT_15400
   00562 Inositol phosphate metabolism
    PTT_15400
Enzymes [BR:pte01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PTT_15400
Exosome [BR:pte04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PTT_15400
  Exosomal proteins of bladder cancer cells
   PTT_15400
  Exosomal proteins of melanoma cells
   PTT_15400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-ProteinID: EFQ88657
UniProt: E3S053
Position
Unknown
AA seq 248 aa AA seqDB search
MGRQFFVGGNFKMNGTMKSITDIVENLNKAQLDPNTEVVIAPPSLYLLPTRQQLRKGIEV
AAQNIFDKPNGAFTGEISVEQLKDSGITWTLIGHSERRQILQETDDFVASKTKAAIDGGL
GVILCCGESLEQREAGETVNVVTKQLKAVADKVKDWSKIVVAYEPIWAIGTGKVATTEQA
QEVHAALREWLKKEISAEAAEKTRILYGGSVSEKNCKELAKQADIDGFLVGGASLKPAFV
DIINSKQA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgccaattcttcgtcggtggaaacttcaagatgaacggtacgatgaagtcgatc
accgacatcgtcgagaacctaaacaaggcccaactcgaccccaacacagaggttgtcatc
gcacccccatccctatacctcctccccacacgccagcagctccgcaagggcatcgaagtc
gcagcgcaaaacatcttcgacaagcccaacggtgcctttaccggtgagatctctgtcgaa
caactcaaggacagcggtattacgtggactcttatcggccactctgagcgtcgtcagatt
ctacaagagacggatgactttgttgcgagcaagaccaaggcggctatcgacggtggcctc
ggtgtgattctgtgctgcggtgagagcctcgagcagcgtgaggctggtgagacggttaac
gttgtcaccaagcagctcaaggctgtcgcagacaaggtcaaggactggagcaagattgtc
gtcgcctacgagcctatctgggccatcggtaccggcaaggtcgccaccaccgaacaagca
caagaggtccacgccgctctccgtgagtggctcaagaaggagatctctgctgaggcggcc
gagaagacacgcatcctgtacggaggcagtgtctcggagaagaactgcaaggagctagcc
aagcaggccgacattgatggtttcctcgtcggtggtgctagcttgaagcctgcgtttgtc
gacattatcaacagcaagcaggcatga

DBGET integrated database retrieval system