KEGG   Pyrenophora teres: PTT_15406Help
Entry
PTT_15406         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
pte  Pyrenophora teres
Brite
Enzymes [BR:pte01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PTT_15406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 903 aa AA seqDB search
MSNQQRSSPASARPGTPRGARQSVNNDANLLSHPLKRLSLHTPSNTTLPKSPAVTSTLRR
TPSTPNFAGGNAIQRSPSVASFRSSTSALGRKTSTSSLRGDMARPGTPRGSGSRRSSFNP
SMQSPIPKSPLGPAHPPEKPPLRACDVAEEYFKKELARHEGMAGAVNAGTLVIVHDQCYG
HRYSRPKTPKGHLSLIMERPERILASVLGISTAYVRLGERHAEGNHPPHPTHSPPARIPF
KIRKTSRVVDITSPVVTNVHGTKWMNELKSLCNNAERKLATTGKELARDTSAASGRGSKQ
QELHSGDLYLCAESLNAFQGALGGVLDAVDAVFQGTSMGDGPSRAFVCVRPPGHHCSDDF
PSGFCWLNNVHVGIEHAMMEYNVTHAAIIDIDLHHGDGSQAITWARNKKVQNMPKNTPNW
KKTSIGYFSLHDINSYPCEDGDDDKVQAASLCIDNAHGQSIWNIHLQSWETPAQFWAIYE
DKYMVLLEKTRQYLKHHTQRLQNTPNHPAPKAVIFLSTGFDASEWETAGMQRHSVNVPTE
FYARFTRDVVRLAEEEGTSVEGRVISVLEGGYSDRALTSGVFSHLTGLVDGQAFTNAHPP
KGLGFSMQPRQRLSGLSIQSFQDDDDPMQSIEEELRPVTYDPNWWHVSRLAELENLVNPP
PAYVPKVPRVGPPAHFSSPTQSYVAKVVDPSKLNRNLSAKYASPSRPVTPPPPDVDWATA
AHALSSLLIPTDRQTRSHQPEDLMEVKVKKEKPVAPAPPIVQGDGSGRQLRGRKPALSYA
ERVSEDEKARSSRRQTIADFAPNGEAPAPPRSAARRMSIASSVSSIGDGRSVSRAPSVAA
SRRNVAPSAPTNGVTQKKPRGQTTAATARAPQRPAISRIPSSQNLKASAPKGKENDGLEA
LTS
NT seq 2710 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatcagcagcgttcgagccccgcgagtgcgaggcctggcaccccacgaggggcg
cgacagtcagtaaacaatgacgcgaacctcctatcacacccgctgaagcggctctcacta
catacgccctccaacacgacattgccaaagtcacccgcagtaacttcgactctgcgccgt
acaccctcgacacccaactttgctggggggaatgcaattcaacgcagcccgagcgtagcc
agtttccgctcgtcaacgtctgccctgggacgcaaaacctcaacttcctcccttcgtggt
gatatggctcgacctggaacaccgcgaggctcaggctctaggcggtcgtcattcaatcct
agcatgcaatcgcccataccaaagagcccattggggcctgcgcacccaccggagaagccc
ccattacgtgcatgcgatgtggccgaagagtactttaagaaagagcttgcgcggcatgag
ggaatggcaggcgcagttaacgctgggacattggttatcgtacatgaccaatgctacggt
caccgctattccaggccaaagacacccaaaggtcatcttagcctaatcatggagcgccca
gagaggatactggccagtgtcttgggtatctcaactgcctatgtacgtctaggagagcga
catgccgagggaaaccatccaccgcacccgacccatagccctccggcgcgcataccgttc
aagattcgcaagacctcgcgcgtcgtcgacatcacctcaccagtcgttaccaacgtacac
gggacaaagtggatgaacgagttgaagtcattgtgcaataatgcagagaggaagctggcg
acaactggcaaagagctggcaagagatacgtctgctgcgtcaggtcggggatccaagcag
caagagttgcactcgggcgatctctatctctgcgccgaatcgctcaatgcattccaaggt
gctcttggtggcgtattggatgcggtcgacgctgtctttcagggtacgagcatgggagac
ggtccctcgagggcctttgtctgcgtccgcccgcctggacatcattgctctgacgacttt
ccttctgggttttgctggctgaataacgtccatgtcggtattgaacacgctatgatggag
tacaacgtcacacatgcagctatcatcgatattgacctgcaccatggagacggttcgcag
gccataacatgggcgcgtaacaagaaggtccagaatatgcccaagaatacgcccaactgg
aagaagacttcgattggctactttagcttacacgacattaattcttatccttgcgaggac
ggtgatgacgataaagtccaggcggctagtctgtgcatcgacaacgctcacggtcagtcc
atctggaacatacatttgcagtcttgggagacaccagcgcaattctgggcaatctacgag
gacaagtacatggtcttacttgaaaagacacgccagtatctgaagcaccacacccagcgt
ctacagaatactcccaaccatcccgcacccaaagctgtcatctttctgtccacaggtttc
gatgcaagcgaatgggaaacggcaggaatgcagcgccactccgtcaatgtacccactgag
ttctatgcgcgcttcacacgcgacgttgtgcgcttggctgaggaagaaggcacgtcggta
gagggtcgcgttatttcggtactagaaggcggttacagtgatcgagcgcttaccagtggg
gtattcagtcatctcactggccttgtcgacggccaggcctttactaacgcgcatccacca
aaaggtctcggcttctctatgcaaccgcgccaacgacttagtggattgagcatccagagc
ttccaagatgatgacgatccaatgcagtcgattgaagaggagctcaggcctgtcacttac
gatcctaactggtggcatgtttctcgtctagctgagctggaaaacctagtaaatccgccg
cctgcctatgttccaaaggtgccgcgagtcggacctcccgcacacttctcctcgccaacc
caatcttacgtcgccaaagtcgtcgacccgtcgaaactcaatcgcaacctctccgccaag
tacgcctcaccgtctaggcccgttacacctcccccgccagacgttgattgggccactgcc
gcgcatgctctcagcagtctgctcattccaacagatcgacaaacccgcagtcaccagcca
gaagacctgatggaggtaaaggtgaagaaagagaagcctgtcgcgccggcgccacctatt
gtacagggagatggatccggccggcaactgcgcggtcgcaagcctgcactgtcttacgct
gagcgggtttctgaagatgaaaaggctcgatcaagtagacgacaaacaattgcagacttt
gctcccaatggagaagctccagctccgcctcgatccgccgcacgccgcatgagcattgct
tcgagcgtatcatccattggggatggcagaagtgtcagccgcgcacccagtgtggcagcc
agcaggcgaaacgttgcaccttcggcacctacaaatggagttactcagaagaagccgcga
ggccaaactaccgctgctacagcgcgagctcctcagcggccagctatatctcgcatccca
tctagccagaacctcaaggccagcgcacccaaagggaaggagaatgacggtctggaagct
ctcacctcag

DBGET integrated database retrieval system