KEGG   Pyrenophora teres: PTT_15715Help
Entry
PTT_15715         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pte  Pyrenophora teres
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pte01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pte00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 546 aa AA seqDB search
MAVHMRKQPGQLTVVIKLGTSSIVDEKTHQPLLSILSLIVETACSLRTAGHRVVIVSSGA
IGVGLRRMNLPRRPKHLPQVQALAAIGQSRLMSLWDQLFGNLEQPIAQVLLTRNDIADRT
QYQNAQNTFIELLSMGVIPIVNENDTLAVTEIKFGDNDTLSAITAGMVQADYLFLMTDVD
CLYDKNPRSNPDAKAITVVEDIAELAADVSSAGSSLGTGGMSTKIVAARLATSAGVTTVI
TKSDKPGNISSIIAHAEKQRKARMSSRNSVTNFQDDSALVQSISQESHHQDLSASTSTLG
EQQVARTSSPKIEEPVPLHTRFLPISNPIRDRYFWILHGLAPHGTIYIDHGAWAALSDKA
GLLPVGIVEVDGHFAQQEAVRIVVVKRLQNTHHNPKSPTTSTPLQQPNTPSALAHGVHAP
IPIRHPLIHANSSHSIHNPSSHSHSHSHSHSHSHPHSRSSTPHPPNYELHNPAPIEIGRA
VVNYSATEIRRIKGLHSTQISEALGYADSEYIALRENIAFFGGERSRPGTPDFRGGKGSA
VGDETH
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcagttcacatgcgcaagcagccaggccagctcaccgttgtaatcaaactgggcacc
tcttccatagtcgacgagaaaacacaccaaccgctcctctccatcctctcccttattgtc
gaaacagcatgcagtctgcgtactgccggccaccgtgtcgtaatcgtctcctcgggcgcc
atcggagtcggtcttcggcgtatgaaccttccacgtcgccctaaacacctcccgcaagta
caagcgctcgctgccatcggtcagagcaggctcatgtcgctatgggatcagttgtttggc
aacttggagcagcccattgcacaggtgctgctgacacgtaacgatattgcagatagaacg
cagtaccagaacgcccagaatacctttattgagcttctaagcatgggtgtcattcccatt
gtgaatgagaacgacactctggctgttacggaaatcaagtttggtgacaacgatacgctc
agtgctattactgcgggtatggtacaggcagattacctcttcctcatgacggatgtggat
tgcttgtacgacaagaacccacggtcaaacccagacgccaaggcgattaccgtggttgag
gatattgctgagttggcggcggatgtcagttctgcaggaagttcgctgggaactggtggt
atgagtacgaagattgtggcagcgagactagcgaccagcgctggcgttactaccgtcatc
accaagagtgacaaaccaggcaacatttctagcatcattgcacatgcggaaaagcagagg
aaggctcggatgtctagtcgaaactcggtgacaaacttccaagatgacagcgcccttgta
caatccatatctcaagagtcgcaccaccaggatctttcggcctcaacatccacacttggc
gaacagcaagtggcacgaacttcgtcaccgaagatcgaagagcccgtccccctacacaca
cgcttcctccccatctccaacccgattcgcgaccgttacttctggatcctgcatggccta
gctccccacggcaccatctacatcgaccatggcgcatgggctgcactgagcgacaaagca
ggcctcctcccggtcggcatcgtagaggtagacggccattttgcccaacaagaagctgtc
cgcattgtcgtagtaaaacgactccaaaacacgcaccacaatcccaaatctcccaccacc
tcaacacctctccaacaaccaaacacccccagcgctcttgctcacggcgtccacgcccca
atccccatccgccacccactcatacacgcaaactcctcgcactccatccacaacccctct
tcgcactcgcactcacactctcattcccattcccattcccacccccattcccgctcctcc
accccacaccccccaaactatgaactccataatcccgcccccattgagatcggcagagcg
gttgtgaactactcagctacggagattagacgcatcaagggactgcacagtacgcagatt
agtgaggcgctggggtatgcagatagcgagtatattgcgttgagggagaatattgccttc
tttgggggtgagagatcaaggcctgggacgccagattttagaggcgggaaggggagtgct
gtcggggatgagacgcattga

DBGET integrated database retrieval system