KEGG   Pyrenophora teres: PTT_15862Help
Entry
PTT_15862         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K16342  
cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pte  Pyrenophora teres
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pte00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:pte00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pte00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:pte00592]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 833 aa AA seqDB search
MAGYRNTRNAGQLWLRGTRRSLHSARTRIYTSKAAALGIRYGPPSLIATAATGFLSSGYS
PFPVSHPIQLDAPSLKRTIFSGNDEKKKTDTTSAGEAEEQINVQSSRKSGDQDAPPQTRV
AKGYSEEDEEAGQAKSAWQTIAAKFPSSPSPSAIGDTIIDYIVPNWVKVLPGFIRKLQNE
LSMAPGSLAEEIWYEANDPEINPEIIWDASVRVSDELCQEEKSFLEKRAQFTKAALARYL
DIPEAKIHPDDVPVIAMCGSGGGLRALVAGTSSYLSSKEHGLFDCVTYTAGVSGSCWLQT
LYYSDLTQRSHAKMIRHLKNRLGVHIAFPPDALELLVSAPTNKYLLSGLVEKAKGIPDAD
FGLVDIYGALLAARLLVPKGELSVSEYDFKVSHQRRFTDNGSQPLPIYTAVRHEIPLAEQ
SGETDRIAAEAKARKEAWFQWFEFTPYEMWCEELSAGIPTWAMGRRFENGRTVWRDNGLA
LPEVRVPLLMGIWGSAFCATLSHYYREIRPLMKSLTGLGGSIDAMIAERDDDLVKVHPID
PAAMPNYALGMREFLPKTCPESIHVQKNFQFMDAGMSNNLPIYPLLRPGRNVDILVAFDA
SADVKTDNWLKVTEGYARQRGIKGWPVGAGWPPNEEPIEELKEDLDRASAKTPQQAQEKL
DEAQDVSSTQETSNKPNKKSNDLGYCNIWVGSTEERTHDPSDTASSTPPSPTKQATEDWE
LMHPSSGITVIYFPFLANPKVPNVDPKVSDFMSTWNFVYTPEQIDSVVELARANFDEGAE
RTKRTVRAVYERKKAQREQREKDERERRWRWKMRQGRIAGRRVGGEEGGDQFS
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atggccggctataggaacacgcgcaacgcggggcagctttggctgcgcgggacgcgtcgg
agcctacatagcgcgcgtactcgtatatacacgtccaaagccgccgctctcggaattcgt
tatggccctccatctctcattgcgacggccgctactggtttcctgtcttcgggatactcc
ccgttcccagtgtcccatccgatccagcttgatgctccatccctgaaacggaccatcttc
agcgggaatgacgagaagaagaagaccgatacgacatctgcaggggaagccgaggagcag
ataaacgtccaaagctcgcgcaagtcgggtgaccaggatgcgccaccacagacgcgcgtt
gcaaagggatacagcgaagaggacgaagaagctggacaagccaaatcagcctggcagacc
atcgccgccaagtttccgagctcgccgtcaccctctgccattggcgacaccatcatcgac
tatattgttccaaactgggtcaaggtcctccctggcttcattcgtaagttgcagaatgag
ctctcaatggcaccgggatcgctggcagaggagatatggtacgaggcaaacgatcctgag
atcaaccctgaaatcatatgggacgcctctgtgagagtctcggacgaactgtgccaggag
gagaagtcgtttttggaaaagagggcacagttcaccaaggcagcacttgcgcgatatctc
gatattcccgaagccaagatacacccggacgatgtcccagtcatcgccatgtgtggatct
ggtggtggcctgcgcgctcttgtcgcaggtacatcgtcatatctctcttccaaggaacac
ggcctctttgactgcgtcacgtacacagcaggcgtcagtggcagttgctggctccagacg
ctttactactcggatcttactcaacgcagccacgctaaaatgatccgacatctcaagaac
aggctcggtgtgcatattgcctttccacccgacgcgctcgaacttcttgtcagtgcaccc
acgaacaaatatctgctgagtggacttgtcgagaaggccaagggaattccggacgccgac
ttcggactcgtcgatatctatggcgcgttgctcgctgctcgcttgctcgtaccaaaggga
gaactctctgttagcgaatatgacttcaaggtttcccaccaacgacgctttaccgacaac
ggctcccagcctcttcccatctacactgccgtcagacacgagatacctcttgctgaacaa
tcaggagaaacagaccggatcgctgcagaagcaaaggcacggaaagaggcatggtttcaa
tggttcgagttcactccatacgagatgtggtgcgaggagctttcagctggtatccccacc
tgggccatgggtcgccgattcgagaatgggcgaactgtctggcgcgacaacggcttggcc
ttgccagaagtgcgcgttccactcctcatgggcatctggggatctgccttttgcgcgaca
ctatcacactactaccgcgagatccgacctcttatgaagagtcttacaggtctgggcggc
agcatagacgcaatgattgccgagcgcgacgatgacctcgtcaaagtccatcccattgac
cccgccgccatgcccaactacgccctcggcatgcgcgagttcctccccaaaacatgccct
gagagcatccatgtacaaaagaacttccaattcatggacgcaggcatgtccaacaactta
cccatctacccacttctccgtccgggccgcaacgtagacatactcgttgctttcgatgcc
tctgccgacgtaaaaaccgacaactggcttaaagtaactgaaggctacgcccgtcaacgc
ggcataaaaggatggcctgtaggcgccggctggccccccaacgaggagcctatcgaagag
ctaaaggaagatctcgatcgcgcatcagcaaagacaccgcaacaagcccaagaaaagctc
gacgaagcccaagacgtcagcagcacccaagaaacgtccaacaaaccgaacaaaaagtca
aacgatctcggctactgcaacatctgggtcggcagcaccgaagaacgcacccacgacccc
tccgacactgcctcctccaccccaccatcccccacaaagcaagccacagaagactgggag
ctaatgcacccttcctccggtataaccgtaatctacttccccttcctcgccaacccaaaa
gtgcccaacgtcgaccccaaagtctcggatttcatgtcaacctggaatttcgtctacaca
cccgagcaaatcgactccgttgtcgagctcgcccgcgccaactttgacgagggcgctgag
cgcacaaagaggactgttagggccgtttatgagaggaagaaggcgcagagggagcagagg
gagaaggacgagagggaacggaggtggaggtggaagatgagacaagggaggattgcgggg
aggcgggttgggggcgaggaggggggtgatcagtttagttag

DBGET integrated database retrieval system