KEGG   Pyrenophora teres: PTT_16341Help
Entry
PTT_16341         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
pte  Pyrenophora teres
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:pte04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 543 aa AA seqDB search
MATLNTPVSVAEVAEQAGNYTYNVHIPLANWLRTANTMQKEAQVYEAEGNDAQTYLLLYR
HADLVLQKLQAHPDRNKPENRKALNAATAAVSRDLKKLEEIAPRIKKRHEEYEERRKRQQ
QALKSLEEKGARTLSQELDGLSLQDPGTKRRSYDSRPTIDARALENQSLAARLAQREVRR
RDINRRNVRQHGVSEEEEQARRSGGAWDMWQDDLPQQAGDGDDVSSQIQEVARLQQNGHR
TSYSSRPTSQSTSSYHYPTVPYKTSQERWDSSRDPAPARPPKEQIYSSSASQSSPPPLPP
KYTTSTNDPRYQHRPPPVPGKYSESAPPLPGKVPDHRPITPSNELDEFTFKPSAFLENGD
PLRPVFLPSQLRNQFLVSASSNTRLNLETCGMLCGILKSNALFITRLIIPEQTSTSDTCE
TLNEEELFDYCDKEELMVLGWIHTHPTQTCFMSSRDLHTHVGYQVMMPESIAIVCAPTKQ
PSWGCFRLTDPPGKQAILNCSRPGIFHPHDVDNIYTEALKPGHVVELTNAPLEIVDMRPK
KRF
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgctcaacacgcccgtaagcgttgcagaggtggccgaacaggccggcaactac
acgtacaatgttcacatcccactggcgaactggctgcgtacagccaacacaatgcagaaa
gaggcgcaagtctacgaggcagaaggcaatgatgcgcagacgtaccttctcctatatcgc
catgccgaccttgtccttcagaagctgcaagcacacccagacaggaacaagcccgagaac
cgcaaggcgctcaacgctgccacggccgccgtcagtcgcgacttgaagaagctcgaggaa
atcgcgccacgcatcaagaagaggcacgaggagtacgaagagcggaggaagagacagcag
caggctctcaagtctctggaagaaaagggcgccaggaccctctctcaggagctggacggg
ctgtcgcttcaggatccaggcaccaagagacgatcatacgattcgaggccgacgattgat
gcacgcgccctagagaaccagtcactggctgcacgactagcacagcgcgaagtcaggcgg
agagacataaacaggaggaacgtgcggcagcatggtgtgtcggaagaagaggagcaggca
cggcgtagtgggggtgcatgggatatgtggcaggatgacttgcctcagcaagccggcgac
ggagatgatgtgtctagccagatacaagaggttgccaggcttcagcagaacggccacagg
acgtcatattcgtcgcgtccaacgtcccagtctacatcctcatatcactacccgaccgtc
ccatacaaaacgtcccaagagaggtgggactcgtcacgcgatcccgcaccggcgcgaccc
cccaaggagcagatatactcgtcctcggcgtcacaatcatcgccgccaccgctgcctccc
aagtataccacatccacaaacgacccacgataccagcatcgtccgccgcctgttcctggg
aaatactcagaaagcgcaccgccactaccaggcaaagtacccgatcaccggccaatcact
ccttcgaacgagttggacgaatttaccttcaagccatctgccttcctcgaaaacggtgat
ccactgcgacctgtcttccttccctctcaactacgcaatcagttcctcgtatctgcttcg
tccaacacacgtctgaacctcgaaacatgtggtatgctgtgtggaatcctgaagtccaat
gctctcttcattactcgcttaatcatccccgagcaaacgagcacgagcgacacctgcgag
acgctgaatgaagaagagctcttcgactactgtgacaaggaggagttgatggtgcttggc
tggatacacacacatcctacccagacatgcttcatgagcagtagagacttacatactcac
gtcggctaccaggttatgatgccggagagcattgcgattgtgtgtgcaccaacaaaacaa
cccagctgggggtgtttccgcctcaccgatcccccaggtaaacaagccatcctcaactgc
agtcgccctggtatcttccacccccacgatgtcgacaacatctacacggaagccctcaaa
cctggccatgtagtcgagttgacaaacgcgccattggagattgttgacatgcgacctaag
aagcggttttag

DBGET integrated database retrieval system