KEGG   Pyrenophora teres: PTT_16341Help
Entry
PTT_16341         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
pte  Pyrenophora teres
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pte00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PTT_16341
Enzymes [BR:pte01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PTT_16341
Peptidases [BR:pte01002]
 Metallo Peptidases
  Family M67
   PTT_16341
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 543 aa AA seqDB search
MATLNTPVSVAEVAEQAGNYTYNVHIPLANWLRTANTMQKEAQVYEAEGNDAQTYLLLYR
HADLVLQKLQAHPDRNKPENRKALNAATAAVSRDLKKLEEIAPRIKKRHEEYEERRKRQQ
QALKSLEEKGARTLSQELDGLSLQDPGTKRRSYDSRPTIDARALENQSLAARLAQREVRR
RDINRRNVRQHGVSEEEEQARRSGGAWDMWQDDLPQQAGDGDDVSSQIQEVARLQQNGHR
TSYSSRPTSQSTSSYHYPTVPYKTSQERWDSSRDPAPARPPKEQIYSSSASQSSPPPLPP
KYTTSTNDPRYQHRPPPVPGKYSESAPPLPGKVPDHRPITPSNELDEFTFKPSAFLENGD
PLRPVFLPSQLRNQFLVSASSNTRLNLETCGMLCGILKSNALFITRLIIPEQTSTSDTCE
TLNEEELFDYCDKEELMVLGWIHTHPTQTCFMSSRDLHTHVGYQVMMPESIAIVCAPTKQ
PSWGCFRLTDPPGKQAILNCSRPGIFHPHDVDNIYTEALKPGHVVELTNAPLEIVDMRPK
KRF
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgctcaacacgcccgtaagcgttgcagaggtggccgaacaggccggcaactac
acgtacaatgttcacatcccactggcgaactggctgcgtacagccaacacaatgcagaaa
gaggcgcaagtctacgaggcagaaggcaatgatgcgcagacgtaccttctcctatatcgc
catgccgaccttgtccttcagaagctgcaagcacacccagacaggaacaagcccgagaac
cgcaaggcgctcaacgctgccacggccgccgtcagtcgcgacttgaagaagctcgaggaa
atcgcgccacgcatcaagaagaggcacgaggagtacgaagagcggaggaagagacagcag
caggctctcaagtctctggaagaaaagggcgccaggaccctctctcaggagctggacggg
ctgtcgcttcaggatccaggcaccaagagacgatcatacgattcgaggccgacgattgat
gcacgcgccctagagaaccagtcactggctgcacgactagcacagcgcgaagtcaggcgg
agagacataaacaggaggaacgtgcggcagcatggtgtgtcggaagaagaggagcaggca
cggcgtagtgggggtgcatgggatatgtggcaggatgacttgcctcagcaagccggcgac
ggagatgatgtgtctagccagatacaagaggttgccaggcttcagcagaacggccacagg
acgtcatattcgtcgcgtccaacgtcccagtctacatcctcatatcactacccgaccgtc
ccatacaaaacgtcccaagagaggtgggactcgtcacgcgatcccgcaccggcgcgaccc
cccaaggagcagatatactcgtcctcggcgtcacaatcatcgccgccaccgctgcctccc
aagtataccacatccacaaacgacccacgataccagcatcgtccgccgcctgttcctggg
aaatactcagaaagcgcaccgccactaccaggcaaagtacccgatcaccggccaatcact
ccttcgaacgagttggacgaatttaccttcaagccatctgccttcctcgaaaacggtgat
ccactgcgacctgtcttccttccctctcaactacgcaatcagttcctcgtatctgcttcg
tccaacacacgtctgaacctcgaaacatgtggtatgctgtgtggaatcctgaagtccaat
gctctcttcattactcgcttaatcatccccgagcaaacgagcacgagcgacacctgcgag
acgctgaatgaagaagagctcttcgactactgtgacaaggaggagttgatggtgcttggc
tggatacacacacatcctacccagacatgcttcatgagcagtagagacttacatactcac
gtcggctaccaggttatgatgccggagagcattgcgattgtgtgtgcaccaacaaaacaa
cccagctgggggtgtttccgcctcaccgatcccccaggtaaacaagccatcctcaactgc
agtcgccctggtatcttccacccccacgatgtcgacaacatctacacggaagccctcaaa
cctggccatgtagtcgagttgacaaacgcgccattggagattgttgacatgcgacctaag
aagcggttttag

DBGET integrated database retrieval system