KEGG   Pyrenophora teres: PTT_16469Help
Entry
PTT_16469         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pte  Pyrenophora teres
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PTT_16469
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PTT_16469
   00630 Glyoxylate and dicarboxylate metabolism
    PTT_16469
Enzymes [BR:pte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PTT_16469
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 543 aa AA seqDB search
MAANPDSILREVNILGELNDQNRHILSKDACVFLALLHRTFNERRKALLQRRVIRQAELD
KGNLLDFLPETKHIRENDTWKGAPPAPGLVDRRVEITGPTDRKMVVNALNSNVWTYMADF
EDSSAPTWDNMINGQVNLYDAIRKQVDFKQGEKEYKLRTDRTLPTLIARARGWHLEEKHF
TVDGEPMSGSLFDFGLYFFHNAHELVKRGTGPYFYLPKMESHLEARMWNDAFNLAQDYIG
MRRGTIRATVLIETITAAFEMDEIIYELRDHSAGLNCGRWDYIFSTIKRFRQNPNFVLPD
RDSVTMTSPFMDAYVKLLIKTCHKRGVHAMGGMAAQIPIKNDPQANEAAMAKVRSDKLRE
ARAGHDGTWVAHPALAAIASEIFNEHMPTPNQMHVRREDVHITANDLLNMNVPGKITEEG
IRKNLDIGLAYMEAWVRGVGCVPINYLMEDAATAEVSRSQLWQWARHNVETAEGKKVTKD
YALKLLHEQAKALSDKAPKGNKYHLAAKYFEGQVTGEDYAEFLTSLLYNEITNVGPPKGA
SKL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaaccctgacagcattctgcgcgaggtcaacatcctcggcgagctcaatgac
cagaaccgtcacatccttagcaaggacgcctgtgtcttccttgcgctcctccaccgcaca
ttcaacgagcgccggaaagcgcttctacagcgacgggtaatccgccaggctgagctcgac
aagggaaaccttctcgacttcctcccagagacgaagcacattcgtgagaatgatacgtgg
aagggcgcaccaccagcgccaggtctcgttgataggcgcgtcgagatcacaggcccgact
gatcgcaagatggttgtcaatgccttgaactcgaatgtctggacatacatggccgatttt
gaggattcgtctgcgccgacatgggacaacatgatcaatggccaagtcaacctgtacgat
gccatccgcaagcaagtcgacttcaagcaaggcgaaaaagagtacaagctgcgtaccgac
cgaacacttcccacactcattgcgcgcgcccgaggatggcacctcgaggagaagcacttc
accgtcgacggcgagcccatgtctggcagtctcttcgactttggactgtacttcttccac
aacgcacacgagcttgtcaagcgcggaaccggaccatacttttacctgcccaagatggag
tcgcatctcgaggcgaggatgtggaacgatgcgttcaacctggcacaggactacattggc
atgaggcgtggaactatccgtgctactgtcttgatcgagaccatcacggccgcttttgag
atggatgagatcatctacgagctccgcgatcactctgctggtctgaactgcggtcgctgg
gactacatcttcagcaccatcaagcgtttccgccagaaccccaacttcgtcctacccgac
cgcgactccgtcaccatgacatcgcccttcatggacgcctacgtcaagctcctcatcaag
acatgccacaagcgaggcgttcacgccatgggcggcatggccgcacaaatccccatcaag
aacgacccacaagcaaacgaggctgccatggcaaaggtgcgctctgacaagctccgcgag
gcacgcgccggtcacgatggcacatgggtcgcccacccagccctcgcagctattgcgagc
gaaatattcaacgagcacatgccaacccccaaccaaatgcacgtccgccgcgaagacgtc
cacatcacagccaacgacctcctcaacatgaatgtacctggaaaaatcactgaagaaggt
atccgcaaaaacctagacattggcctcgcttacatggaagcctgggtccgtggcgtcggc
tgcgtgccaatcaactacctcatggaagacgccgccactgctgaagtctcacgaagtcag
ctctggcaatgggctagacacaatgtcgagactgcagagggaaagaaggtcaccaaagac
tatgctctcaagcttctccacgaacaggccaaggcgctcagcgataaggcgccaaagggg
aacaagtaccatcttgctgccaagtactttgaaggacaggttacaggcgaggattatgca
gagttcttgacttctttgctatacaacgaaatcacaaatgtaggtccacccaagggagcg
tcaaagttgtaa

DBGET integrated database retrieval system