KEGG   Pyrenophora teres: PTT_17003Help
Entry
PTT_17003         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
pte  Pyrenophora teres
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PTT_17003
Enzymes [BR:pte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     PTT_17003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 493 aa AA seqDB search
MPAKPTLPAGNGAPREMRMAETPDVTTAAAPRRRKPRAKANKVEDEGLIASLCTLICDHQ
IGISVNLLTLLTLTHTFFPRARSRTAKFFHMSYYNPETDMYGCGTDDLSFVLLWTVIFTG
LRVVVMDYLLDPLARLGGIRSKKGLDRFKEQAWLVIYYIGSWSLGMYIMYHSDFWLSLHG
IWEGWPFREADGLFKWYYLVQWAFWVQQILVVNIEEKRKDYVQMFTHHVFTIALMFLSYG
YYHMRVGIVILTIMDFVDIILPTAKLLKYTGYSNACDYAFGVFVLSWIGTRHILYMMVCW
SIYAYAPVDMAPGCYLADSTSKLSGFVPASNTSQFEAYGGNNHWGNLLKAYDDRNGPICW
NPHIRYYFLALLLVLQVFCCIWFGTIAKVVYKVLNGTGADDLRSDDECDEEEVQHDKTRT
ILNMATTCTESGMSSMTPKEEEVGVDALTFARINGASQRRQARRESSRASGISIPGHGDR
KELLGRIGCDKPS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccaagccgacgctgccagctggcaatggcgcgccgcgagagatgcgcatggcg
gaaaccccagacgtgaccacggccgcggcacccaggaggcgcaagccgagggcgaaggcg
aacaaggtcgaggatgaggggctcatcgcctcgttgtgcaccctcatctgcgaccaccag
attggtatctccgtcaacctgctcaccctcctcacattaacccacaccttttttccccgc
gcccgaagtcggaccgccaaattcttccacatgtcgtactacaaccccgaaaccgacatg
tacggctgtggcaccgatgatctgtcgtttgtcctactgtggaccgtcatattcacaggc
ctgcgggtagtagtcatggactacctgctggatcccctggccaggctcggtggcatcagg
tcgaagaaggggcttgatagattcaaggagcaggcatggctcgttatctactacattgga
tcgtggtcgctaggcatgtacatcatgtaccactcagatttctggctcagcctccacggc
atttgggaaggctggccctttcgcgaggccgacggtcttttcaagtggtactatctcgtt
caatgggccttttgggtccagcagattctcgtcgtcaacattgaggagaagcgcaaggat
tacgttcagatgttcactcaccacgtcttcaccattgcgctcatgttcttatcttatgga
tactaccacatgcgtgtcggtatcgtcattctgaccatcatggactttgtcgacatcatt
ttgcccacggccaaactcctcaagtacacgggatattcgaatgcttgcgactatgccttc
ggcgtctttgtcctctcgtggataggcacccgccatatcctatatatgatggtctgttgg
tccatctacgcctacgcccccgttgatatggctcccggctgctacctcgccgactcgacc
tcgaaactatccggcttcgttcccgcgtccaatacctcacaattcgaagcatatggcgga
aacaatcactggggcaatcttctcaaggcatatgatgaccgcaacggacccatctgctgg
aaccctcatatccgatactatttcctcgctctcctcctcgtgctgcaggtcttttgctgc
atatggttcggtaccattgcgaaggtcgtgtataaagtactcaacggcactggtgctgac
gacttgcgctcagatgacgagtgcgatgaggaagaggtccagcacgacaagaccaggacc
atcttgaacatggcaaccacgtgcaccgaaagcggcatgagctcaatgacgccaaaggaa
gaggaggttggtgtcgatgcactcacctttgcccgcataaacggcgccagccagcgacgg
caagcgaggagagaaagttctcgagcgagtgggattagtattcccggacatggcgatcgc
aaggagttattaggccgcattgggtgcgataagccttcatag

DBGET integrated database retrieval system