KEGG   Pyrenophora teres: PTT_17220Help
Entry
PTT_17220         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pte  Pyrenophora teres
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 353 aa AA seqDB search
MHIPYLATALAVTGLVAATPIEPRQAAQLDPAIRARGRSYVGTSLTIRNDATEQNIIKST
EFGSITPENAMKWDATEPSRGSFTFSGADAVANFATANNKQLRCHTLVWYSQLPAWVSQI
TNNATLISVMQNHITTLVTRYKGKCTHWDVVNEALNDDGTYRNDVFQRVIGEAYIPMAFK
MAAAADPNVKLYYNDYNLESGGVKHAAAMKIVRLVQSYGVKINGVGFQAHLASESTASSG
SLPSLAVLTKSLQDVANLGVDVAYTELDIRSTLPATSAKLAAAATAWARVAQSCLNVRQC
VGITVWGVSDKYSWIPGIFRTEGSALLWDDNFAKKPAYTSFLNVLNGQSVTSK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcccttaccttgccacagccctggcagtcaccggcttggttgcagccacgcca
atcgaaccacgtcaagcagctcagctcgacccagcaatccgagccagaggccgaagctac
gtcggaacctcgctcacaatccgcaatgacgctacggagcagaatatcatcaagagtaca
gaattcgggtctattacgcccgagaatgcaatgaagtgggacgctacggagccgagtcgg
ggatcgtttacttttagtggggcagatgctgttgcgaactttgcgacagcaaacaacaaa
cagcttcgctgccatacattggtctggtatagtcagctaccggcctgggtcagccagatc
accaacaacgcaacgttgattagcgtcatgcaaaaccacatcacaacactcgtgactagg
tacaagggcaaatgtacacactgggacgttgtcaacgaagcactcaatgatgatggtacc
tacagaaacgacgtattccaaagggtcattggcgaagcctacatccccatggccttcaaa
atggccgctgctgccgacccaaacgtcaaactttactacaatgactacaatctcgagagc
ggaggtgtcaaacacgctgccgctatgaagattgttaggctcgttcaatcttatggcgtg
aaaatcaacggcgttggtttccaagctcacttggcatccgagtccacggcgagttcaggg
tcgttgcccagccttgcagtcttgaccaagtcgctccaagatgttgctaatctaggtgtt
gacgtcgcgtatactgaactggatatcaggtccactttaccagctaccagtgccaagttg
gcggctgctgcgactgcttgggccagggttgcgcagtcatgcctcaatgtcagacaatgc
gttggtatcaccgtctggggcgtttcggacaagtactcttggattccaggcattttcaga
acggaaggatctgcccttttgtgggacgacaattttgcgaagaagcctgcttacacttcg
ttcttgaacgtgctgaatgggcagtctgttacgtcaaagtga

DBGET integrated database retrieval system