KEGG   Pyrenophora teres: PTT_17481Help
Entry
PTT_17481         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pte  Pyrenophora teres
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:pte01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pte00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pte00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 462 aa AA seqDB search
MSGQQCLRRLPAAMRSVRALRAAPRTIPAARTYSAITKANSSGLLGQSSRRPGQLSSQRL
WTLEQTRNYADTVVKVPEMAESITEGTLKQWSKQVGDYVEQDEEIATIETDKIDVAVNAP
EAGTIKEFLVNEEDTVTVGQEIVRLEAGGEAPAKTEAKDEPKEPASSEQETSSQPEGQQE
KSEAPKEESKPEPTKQEQKPQPTKESKPQPPKKESKPQDEPKPATPGSREERRVKMNRMR
LRIAERLKQSQNTAASLTTFNEVDMSSIMEFRKLYKDEILKNKGVKLGFMSAFSRACILA
ARDVPAVNASIEGPDGGDTIVYRDYVDISVAVATEKGLVTPVVRNAESLDMVGIEKAIAD
LGKKARDNKLTIEDMAGGTFTISNGGVFGSLMGTPIINLPQTAVLGLHAIKEKPVAINGK
VEIRPMMYLALTYDHRLLDGREAVTFLVKVKEYIEDPRKMLL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtcagcagtgcctccgccgcctaccagctgctatgcgctctgtgcgagctttg
cgcgccgcaccaaggaccattccagctgcgcgtacctactctgccatcaccaaggcgaac
tcgtccggtcttctgggtcagtcttcaagacgacctggacagctctcttcgcagcgcctg
tggaccctcgaacagacacgaaactatgccgacaccgtcgtcaaggtgccagaaatggcc
gagtccatcactgagggaaccctaaagcaatggtcaaaacaggtcggcgactacgttgag
caggacgaagaaatcgctaccattgaaaccgacaagatcgacgttgccgtgaatgcgccc
gaagctggtaccatcaaggaattcctggtaaatgaggaggacaccgtcacggttggacaa
gaaatcgtaaggctagaggctggtggagaagcaccagcaaagacagaagccaaggatgag
ccaaaggagcccgcttcctcggagcaggagacttcgtcgcaacctgaaggtcaacaagag
aagtccgaggcgccaaaggaggagtcaaaacctgagccgaccaagcaagaacagaagccc
cagccgaccaaggaatccaagcctcagccacccaagaaggagtcaaagccccaggatgag
cccaagccggccacgcctggtagccgtgaggagcgtcgcgtcaagatgaaccgcatgcgt
ctccgcatcgccgagcgcttgaagcagtcgcaaaacaccgccgcctccctgaccacgttc
aacgaagtcgacatgtcgtcaatcatggagttccgcaagctctacaaggatgagatcctc
aagaacaagggcgttaagctcggtttcatgtccgccttctcgcgcgcctgcatcctcgcc
gcacgcgacgtacccgctgtcaacgcctcgattgaaggacccgacggcggcgacaccatc
gtctaccgcgactacgtcgacatctcggttgccgtcgctaccgagaagggcctggttaca
ccggttgtcaggaatgcggaaagcttggacatggtcggtatcgagaaggccattgccgac
ttgggcaagaaggctcgcgacaacaagctcaccatcgaagacatggctggtggtaccttt
accatctccaacggcggtgtctttggtagcttgatgggcactcccatcatcaaccttccc
cagacggcagtcttgggtctgcacgccatcaaggagaagccggttgcgatcaacggaaag
gtagagattcgacccatgatgtaccttgcactcacatacgaccaccgactgctcgacgga
agggaagccgttaccttcttggtaaaggtcaaggagtacattgaggacccgaggaagatg
ctgttgtag

DBGET integrated database retrieval system