KEGG   Pyrenophora teres: PTT_17483Help
Entry
PTT_17483         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
pte  Pyrenophora teres
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 138 aa AA seqDB search
MPPKAQKTPTTGGKAPAGKAPAEKKEAGKKTAAPSGDKKKRTKTRKETYSSYIYKVLKQV
HPDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELAK
HAVSEGTKAVTKYSSSTK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaaagcacagaagactcccaccaccggcggcaaggccccggctggcaaggct
cccgctgagaagaaggaggctggcaagaagaccgccgcgccctctggcgacaagaagaag
cgcaccaagaccaggaaggagacctactcttcctacatctacaaggtcctcaagcaggtc
caccccgacaccggaatctccaaccgtgccatgagcatcctcaactcctttgttaacgac
atcttcgagcgtgttgccactgaggctagcaagcttgctgcctacaacaagaagtccacc
atctcatcgcgcgagatccagacatcagtccgtcttatcctgcctggtgagcttgccaag
cacgccgtttccgagggtaccaaggccgttaccaagtactcttcatccaccaaatag

DBGET integrated database retrieval system