KEGG   Pyrenophora teres: PTT_17572Help
Entry
PTT_17572         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K14152  
phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase / histidinol dehydrogenase [EC:3.6.1.31 3.5.4.19 1.1.1.23]
Organism
pte  Pyrenophora teres
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pte01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pte00340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 950 aa AA seqDB search
MAPTLVAAIDLATYTQSTQGLDAQALSYVGNVFIQVTDATIDQALDHLKRSVGRFANYLG
VTSVTSMDDVLSLLDAGAAKIFVTRQQLDELKALKIDQDRIVLCLPGNTKEEIMEAIAGT
QVDVYAHQVQDVGFVEAWLKDYGTDRPGFFVSFAQPNMDSVTRLAKLSAIPIVSAENLTI
DPSKQGGALSVAKLVMANATSDRPDGLFTTLVTDERGIALGLVYSSEESVAESLRTGRGV
YQSRKRGLWYKGESSGDVQELVSLSLDCDSDCLQFVVRQQGRGFCHLATPTCFGEYSGLS
KLQKTLQSRKSSAPEGSYTARLFNDEQLLRAKILEEATELCNANTKEEVAFEAADLFYFA
LTKCVAAGVSLEDVERNLDAKSIKVKRRQGDAKPAFAAQAAATTTTQGTTSDASTKEIVK
EAASIPKSKDDPAGTRNGRIAMRRYVTANESPETISAALQRPSQRSSEKILGICQPIIEA
VRTRGDAALLEYTHKFEKATSLTSPVLRAPFPPELMQLAPETAKAIDISFENIRKFHAAQ
KEDKPLRVETMPGIVCSRFARPIERVGLYVPGGTAVLPSTALMLGVPAMVAGCKKIVLAT
PPRSNGQVTPEVVYVAHKVGAESIVLAGGAQAVAAMAYGTESVSKVDKILGPGNQFVTAA
KMHVSNDTNAGVSIDMPAGPSEVLVIADAAANPAFVASDLLSQAEHGVDSQVILIAVGLN
ESQLGAIEDELHTQAIALPRVDIVRGAIEHSLTLAVSTMDEAMELSNQYAPEHLILQVNE
AEKVAEMVENAGSVFIGEWTPESVGDYSAGVNHALPTYGYAKQYSGVNLASYVKHITSSH
LTRQGLENVGAAVMELARVEELEAHRRAEGVIVLNLVIELETLSEMELAWEENQVPPDRD
IQFEKVRLRKRYSTTSALHEYCDNADAQSNSIYAASASTAPKSIQELQRT
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atggctccgacactggtggctgcaattgacttggctacgtacacacaatctacccagggt
cttgatgcgcaggcattatcatacgtcggcaatgtctttatccaagtcacggacgcgact
atcgaccaggccctggatcacctgaagcgatcggtaggccgtttcgcaaactacctaggc
gtcacttcagtcacgtccatggacgatgtcctctcacttctcgatgccggcgccgctaag
atcttcgttacccgccagcaactagacgagctcaaggcgctgaagatagatcaggacagg
attgtcctgtgcttaccgggaaacacaaaggaagaaatcatggaggctatagcaggaacg
caggtggatgtttatgcccaccaggtgcaggatgttggttttgtcgaggcatggctgaag
gattatgggactgacagaccgggcttcttcgtctcctttgcgcagcccaatatggacagt
gttacaagacttgcgaagctgtcagcaatccccattgtatctgctgaaaatctcaccatc
gacccttcgaagcaaggaggcgcattgagtgtcgcgaagctcgtcatggccaacgcaacg
agcgaccggcccgatggccttttcaccacacttgtgactgacgagcggggtatcgcgcta
ggactcgtgtacagcagtgaagagagtgtcgccgaaagtctaagaacgggacgcggggta
taccagagtcgaaagcggggattgtggtacaagggcgaaagcagcggggacgtacaggag
ctggtatctttgtcgctcgactgcgacagcgattgtctacagtttgtggtgcgacaacaa
ggcagaggcttttgccatctggcaacgcctacttgttttggcgagtacagtggcttatca
aagctgcagaagacactgcagagccgcaaatcctcagccccagaaggctcatatactgcg
cgtctcttcaatgatgagcagcttttgcgcgcaaagatactagaagaggctaccgagctc
tgcaatgccaacaccaaagaggaggttgcctttgaagcggctgatctcttctactttgcc
ctcaccaaatgcgtagctgccggtgtatcattagaggatgttgagcggaacctggatgca
aagagtatcaaggtcaagaggcgacagggcgatgctaagcctgcatttgccgcacaggca
gcagcaacaacaacaacacagggaactaccagtgatgcaagtaccaaagagatagtaaag
gaggctgcgtcgatacccaagagcaaagacgacccggcgggtacaaggaatggccgcatc
gctatgaggcgatacgtaacagcaaacgagagcccagagaccatcagcgctgcattgcaa
agaccatcgcaacgttcatccgagaagattctgggtatatgtcaacccataatcgaggct
gtccggacgcgcggagatgctgcgttactcgagtatacgcacaagtttgagaaagctaca
tcgttgacctcgcccgtgttgagagcacctttcccaccagaacttatgcaactggccccc
gagaccgccaaggccattgatatatcgtttgagaacatccgtaaatttcacgctgcgcag
aaagaagacaagccgcttagggtggagactatgcctggaattgtatgttcgcgctttgct
cgacccattgaaagggtaggtttgtatgtacctggcggtacagctgtgcttccctccacc
gcgctcatgcttggtgtgccggccatggttgctggctgcaaaaagattgttctcgctacg
ccgccacgatccaacggtcaagtaaccccggaagtcgtctacgtcgctcacaaagttggc
gcagagtccatcgtacttgctggaggagcacaagctgttgcagccatggcatacggtact
gaaagcgtatccaaggttgacaaaatcttgggccccggcaaccaatttgttacagcggca
aaaatgcacgtctccaatgacacaaatgccggagtaagcatcgacatgccagcgggaccc
agtgaagtccttgtgattgctgatgcagctgccaaccccgcgtttgtcgcatcggaccta
ctcagtcaagccgagcatggcgtcgactctcaggtcatcttgatcgcggttggactgaat
gaatcccagctcggtgcaattgaggatgagttacacacacaggcaattgctctaccgcgc
gtggatattgtccgcggcgcgatcgagcactcgcttacactcgccgtcagtacaatggat
gaagctatggagctaagcaaccagtacgcaccagaacatcttatcctccaggtcaacgag
gcggagaaggttgcggaaatggtagagaatgctggaagtgtgttcatcggcgaatggaca
ccagaaagtgttggtgactactccgccggtgtcaaccatgctttaccaacatacggatac
gcaaagcaatactctggtgtaaacttggcgtcttatgtcaagcacatcaccagttcccac
ctcactagacaaggtcttgagaatgtgggcgcagctgtgatggagctcgcgcgcgtcgaa
gaactagaggcccaccgtcgcgctgaaggggttattgtgctcaacttggtcattgaactg
gaaacactctctgaaatggagctggcttgggaagagaaccaggttccacctgatagagac
attcagtttgagaaagtccgattaagaaagcggtacagcacgacgagtgcgcttcatgaa
tactgcgacaacgcagatgcgcaatccaactcaatatatgcagcgtctgcaagcactgca
ccaaagtcaatccaagagttgcagcgaacatga

DBGET integrated database retrieval system