KEGG   Pyrenophora teres: PTT_17668Help
Entry
PTT_17668         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
pte  Pyrenophora teres
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PTT_17668
Enzymes [BR:pte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PTT_17668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 525 aa AA seqDB search
MLHQLVLLTGLFHYSYAFSIPPLPRLSTFVGASHAQEQQQPLQDTLEAWIANEERIALDK
LLANVAPGGSNVKGKGVADGTVIASPSHTAPDYWFQWVRDAAITMDTVVDVYAEDPTSSR
ASSLSTILDAYASLQRDIQHTSNPSGKFDDLSGLGEPKFQVDGKPFTGSWGRPQRDGPAL
RALTLMHYLREYNSSHPSLWTSASSADFFRPFYAVEMPPRSVIKADLEYVSHFWNQSSFD
LWEEVEGLHFFNLMVSAKSLREGSSLARTFGDHGAAEWYEKQAGYIENLLAKFWNAQKGH
LVETLWSKRSGLDCGLLLGSLHGQSSEGSAHEAVYPPWSDEILVSLLALTHDQRDRFPIN
SRPSGENQDDDVNEESFQGTGIGRYPEDVYDGYGNSNRGGNPWFLCTSSAADILYRTASH
ISVAGNLTITDVGLPFYESLLASSSLDVNVGTFGPSDALFYSVIERLQFTADQFLEVVKS
HVDSEGSMSEQFDRVTGFMRGAVDLTWSYGAFLHAVRARKVLKAL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgctacatcagctggtcctccttacgggcttgttccactattcctatgccttctccata
ccacctctacctcgcctgagcacctttgtgggcgccagccatgcacaagaacagcagcaa
ccgctacaagacacacttgaagcctggatagcaaatgaagagcgcattgcgctggacaaa
cttctggcgaatgtcgcgccgggtggcagcaatgtcaaaggaaaaggcgtcgcggatggc
acagtaattgctagcccaagccacactgcccctgactattggttccaatgggtccgagat
gcagccatcaccatggacaccgtcgtagacgtctacgccgaagatccaacttcctcccgc
gcatcctcactctccaccattctcgatgcctacgcttctctccaacgcgatattcaacat
acatcaaacccctcgggtaaattcgacgacctatctggtcttggagagcccaagttccaa
gtcgatggcaagccattcacaggctcatggggcaggcctcagcgcgacggcccagctcta
cgcgctctgacgcttatgcactacctccgtgaatataactcctcacacccctcgctctgg
acctctgccagttcagcagatttcttcagaccattctacgctgtggaaatgccgcctcgc
agcgtcatcaaagcggatttggaatatgtgagccacttctggaaccagtcttcgttcgat
ctctgggaggaggttgagggattgcacttcttcaacttgatggtcagcgccaagagcttg
agagaaggcagcagcctggcgaggacattcggagatcacggagccgcagagtggtacgag
aagcaagcaggatatatcgaaaaccttttggccaaattttggaatgcgcagaaaggccac
ctcgttgagacgttgtggagcaagcgaagcggcttggactgcggcttgctccttggctcc
ctgcacggccagtcgtctgagggatcagcacatgaagctgtgtaccctccgtggtcagac
gagattctcgtctcgctactcgccctaactcacgaccaacgagaccgctttccaatcaac
agcaggccctctggcgagaaccaagatgatgatgtcaatgaggaatccttccaaggcaca
ggcattggacgttatcccgaagacgtttatgacggctacggcaattcgaaccgtggtggt
aacccctggtttctgtgcacatccagcgctgccgacatcttataccgcaccgcatcgcac
atctccgttgctggcaacttgaccatcaccgatgtcggtctaccgttttacgaatctctc
cttgcatcttcttctctcgacgtcaatgttggtacctttggtccctctgatgcgcttttc
tactctgtcatcgaacgattgcagtttactgccgatcagttcctcgaagtagtcaagtcg
catgtggattctgaggggagcatgagtgagcagtttgaccgcgtcacagggttcatgcgg
ggtgctgttgatttgacctggagctatggagccttcctgcatgctgtccgggctcggaaa
gtgctcaaggctttatga

DBGET integrated database retrieval system