KEGG   Pyrenophora teres: PTT_17704Help
Entry
PTT_17704         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
pte  Pyrenophora teres
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PTT_17704
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PTT_17704
Enzymes [BR:pte01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PTT_17704
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     PTT_17704
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1840 aa AA seqDB search
MASLPDPSQNLALELQDGYVCFGNSFGAEKSISGELVFQTGMVGYPESITDPSYRGQILV
ITFPLVGNYGVPSREDMDSLLEGIPANFESREIHIAGLVVATYAGEKYSHHLATSSLGAW
LKEQGVPAITGVDTRALTKRIREEGSMLGRLLQRTGPTPSSAALTNGAVNTQTLADGEAD
WRSSFEQIEWLDPNTKNLVAEVSIKEPKLWSPDPATALKHPSGRPVRVVTVDVGLKYNQL
RCLVKRGVEVLQVPWDYDFPQLAGKEYDGLFISNGPGDPAMMEPTVKHIKAAMDEARTPI
FGICLGHQLLARAAGASTIKMKFGNRGANIPCTNLLTGKCHITSQNHGYAVDSKTLPNGW
EELFVNANDKSNEGIQHVRRPYFSVQFHPEHTPGPRDTEYLFDVFISTIQKAMAASEVMS
QAVEFPGGTFDENRKLTPRVDVKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTI
LINPNIATIQTSKGLADKVYFLPVNADFVRKVIQKERPDGIYVTFGGQTALQVGIQLKDE
FEGLGVKVLGTPIDTIITTEDRELFARSMESIGEKCAKSASANSVEEAMRVVKDIGFPVI
VRAAYALGGLGSGFANNDAELLDLCNKAFAASPQVLIERSMKGWKEIEYEVVRDSRDNCI
TVCNMENFDPLGIHTGDSIVVAPSQTLSDADYNMLRTTAVNVIRHLGVVGECNIQYALNP
FSKEYCIIEVNARLSRSSALASKATGYPLAFVAAKLGLNIPLNDISNSVTRVTCACFEPS
LDYVVVKIPRWDLKKFTRVSTLLGSSMKSVGEVMSIGRTFEEAIQKAIRSVDPSNLGFNE
TPALMEIDQELQTPSDQRLFAIANAMKAGYSVDKIWEMTQIDKWFLSRLKSLSDFEKSMS
SYTTTSITMPLLKQAKQLGFSDRQLAKFWASNELAVRRVRVDAGIFPVVKQIDTVAAEFP
AVTNYLYLTYNGTENDITFNDKGIMVLGSGVYRIGSSVEFDWCSVRAIRTLREQGFKTVM
LNYNPETVSTDYDEADRLYFECINLETVLDIYTMENSSGVVLSMGGQTPNNIALPLHRMN
VKVLGTSPEMIDTAENRYKFSRMLDRIAVDQPAWKELTSIEEATEFCERVSYPVLVRPSY
VLSGAAMNTVYSKHDLANYLNQAADVSKEHPVVITKYIENAKEIEMDAVANKGTMIGHFI
SEHVENAGVHSGDATLILPPQDLDPETVRQIEDATRKIGQALLITGPYNIQFIAKDNEIK
VIECNVRASRSFPFVSKVMGVDLIEMATKAMAGLPVTEYPPTNIPADYVGVKVPQFSFSR
LSGADPVLGVEMASTGEVACFGRTKYEAYIKGLIATGFRLPNKNILLSIGSFKDKLEMLP
SIERLHKMGYKLFATAGTADYIQEHGIPVKFLEVLSSGEHDEQKQEYSLTQHLSNNLIDL
YINLPSSNRFRRPANYMSRGYQTRRMAVDYQTPLVTNVKNAKLLIEAIARHYDMEISKVD
FQEFAAAPGAHDESSGHMSRLNASLSLSQLLAKSPFKREHITSVKQFTRADLHLLFTIAQ
EMRLGTQRQGCLDILKGRVLCTMFCEPSTRTSASFDAAMKRLGGEVIVINESVSSTQKGE
SVADTIRTLGCYGDAIVLRHPSEESIDIATKFSDVPVINAGNGSREHPTQALLDIFTIRE
ELGTVNGLNITFVGDLKYGRTVHSLCELLSHYDVTINLVSPASLPMPSGVTDALKARGQL
NKVSTELTEDIVASSDVMYCTRVQKERFPDVATYEAVKDSFVIDNKLLKGAKANMIVMHP
LPRNNEINEEVDFDPRAAYFRQMRYGLYTRMALLAMVMAP
NT seq 5523 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgcccgacccaagccagaacttggctcttgagcttcaagatggctatgta
tgcttcggaaacagcttcggtgctgaaaagagtatttccggtgaactcgtcttccagact
ggtatggtcggctaccccgaatcaatcacagatccttcctaccgaggccagatcttggtc
attacatttcctctagtcggcaactatggtgtgccctcgagagaggacatggacagcctg
ctggagggcattccagccaacttcgagtccagggaaatccacattgctggattggtggtt
gccacatacgctggagagaagtattcacatcacttggccacctcttcgctgggcgcatgg
ctcaaggagcagggcgtgcccgccatcaccggcgttgacacgcgagcgctgacgaagcgc
attcgagaggagggaagtatgctgggacgtcttctacagaggaccggcccaacaccctca
tccgccgccctcaccaatggcgcggtcaacacccagaccctcgccgacggtgaggcggac
tggaggtctagtttcgagcagattgagtggttggaccccaacaccaagaacttggttgca
gaagtttccatcaaggagcccaagctctggtcccccgaccctgccactgccctcaagcac
ccctctggccgccccgtgcgtgtcgttaccgtcgacgtcggtctcaaatacaaccagctg
agatgcttggtaaagcgaggagtcgaggtgctgcaggtcccgtgggactacgacttccct
cagcttgctggcaaagagtatgacggtctcttcatctccaacggccctggtgatccagct
atgatggagcccacggtcaagcacatcaaggcggccatggacgaagctcggacaccaatt
ttcggtatctgtcttggtcaccagttgctggcccgcgcagcgggtgctagcactatcaag
atgaagttcggtaaccgcggtgccaacattccctgcaccaacttgcttaccggcaagtgc
cacatcacatcgcaaaaccacggttatgcggtcgactccaagacattgcccaacggctgg
gaggagctcttcgtgaatgcaaacgacaagagtaacgaaggtatccaacatgtgcgcagg
ccctacttcagtgtgcagtttcatccagagcacacccccggtccacgcgatactgagtac
ctgtttgatgtcttcatcagcaccattcaaaaggccatggccgcatctgaagtcatgtct
caggcagtcgagttccctggtggcactttcgatgaaaacaggaagcttaccccaagagtg
gacgtcaagaaggtgcttgtgctaggaagtggaggcttgagcatcggtcaggctggagag
tttgactactccggaagtcaggccatcaaggccttgaaggaagagggtatctacaccatc
ttgatcaaccccaacatcgctaccattcaaacttccaagggccttgccgacaaggtctac
ttcctgccagtcaatgcagactttgtacgcaaggtcatccagaaagaacgacctgacggt
atctacgtcacctttggtggtcagactgcgctccaagtcggtatccagctgaaggacgag
ttcgaaggtctaggtgtcaaggtactcggaacccccattgacaccatcatcactaccgaa
gaccgagagctctttgcacgaagcatggagtccatcggagagaagtgcgccaagtcagct
tcggccaacagtgtggaggaggccatgcgtgtcgtaaaagacattggtttccccgtcatc
gtccgagctgcctacgccctgggaggtctcggcagtggatttgcaaacaacgatgcagag
ttgctcgacctttgcaacaaggcttttgctgctagtccccaggtgctgatcgagcgaagt
atgaagggctggaaggaaatcgaatatgaagtcgtccgtgactcccgagacaactgtatt
acagtttgtaacatggagaacttcgaccccctcggtatccacactggagactccattgtt
gttgcaccctcgcaaacactttcggacgccgactacaacatgctccgaacaactgccgtg
aacgtcatccgccaccttggtgtcgttggtgaatgcaatatccagtacgccttgaacccc
ttctccaaggagtactgcattatcgaagtgaacgctcgtctttcgcgttcttccgctctt
gcctccaaggcgactggctatcctcttgctttcgtcgcagcaaaacttggtctcaacatt
cctctcaatgatatctccaactcagtgacgcgcgttacgtgcgcctgcttcgagccgtcg
ctcgattacgtcgtggttaagatcccccgctgggatttgaagaagttcactcgtgtgtcg
acacttctcggttcatccatgaagagtgttggtgaggtcatgagtattggccgaacgttc
gaagaagctatacaaaaggccattcgctcagttgaccccagcaaccttggtttcaacgag
actccggctctgatggaaatcgaccaagagctgcaaacaccttctgaccagcgactgttc
gccattgccaacgcgatgaaggctggctacagtgttgacaagatctgggagatgactcaa
atcgacaagtggttcctcagccgtctgaagtccctaagtgactttgaaaagtcaatgtcg
agctacactactaccagcatcaccatgccgttgctgaagcaagcaaaacaactaggattc
tccgatcgtcaactcgccaagttctgggcttccaacgagcttgcggtacgtcgcgtacgt
gtcgatgccgggattttcccagtagtcaagcagattgacactgtcgcagccgagttcccc
gcggtaacaaactatctgtatctcacatacaacggtaccgagaacgacatcactttcaac
gacaagggtatcatggtgctcggttctggcgtgtaccgaatcggatcgtctgtcgagttc
gactggtgctctgtccgtgctatccgcactctcagggagcaaggattcaagacggttatg
ctgaactacaatccggaaaccgtttctaccgactatgatgaagcggaccgtttgtacttt
gagtgcatcaaccttgagaccgttctggacatctataccatggagaactccagcggtgtt
gtactatccatgggcggacaaactccaaacaacattgcgctaccactgcaccgcatgaac
gtcaaagttctcggtacctcgcctgagatgatcgacaccgctgagaaccgttacaagttc
tcccgtatgcttgaccgcatcgctgtcgatcagcccgcctggaaagaactcactagtatc
gaggaggctactgagttctgtgagagggtatcctaccccgtgttggttcgtccctcttat
gtgctctctggtgctgccatgaacacggtttactcaaagcatgacttggccaattacttg
aaccaagcggccgacgtgtctaaggaacacccagtcgtcattaccaagtatatcgagaat
gcaaaggaaatcgagatggacgctgtagccaacaagggtaccatgattggtcacttcatc
tccgagcacgtcgagaacgctggtgtgcattccggtgatgctacgctcatcttgccgccc
caggatcttgaccccgagactgtgcgccaaatcgaagatgcaacaaggaagatcggccaa
gctttgttgatcactggaccctacaacatccagttcatcgccaaagataacgagatcaag
gtcattgagtgcaacgttcgtgcctctcgatccttcccgttcgtgtcaaaggtcatgggc
gttgacctgatcgagatggctaccaaagccatggctggtctacccgtgaccgaatatccg
ccaaccaacatacccgcggattacgtcggtgtcaaggttccgcagttctccttctcccgt
ctttctggtgccgatcctgtccttggtgtggagatggcttcgactggtgaagtcgcctgc
ttcggtcgcaccaagtacgaggcatacatcaagggtctcatcgctactggcttcaggcta
ccaaacaagaacattctgctctctatcggttcgttcaaggacaagctggagatgctgcct
tctatcgaacgcctgcacaagatgggctacaagttgttcgctactgctggaacggccgat
tacatccaggaacatggtatcccggtcaagttcctggaagtactgtctagtggtgagcat
gatgagcagaagcaagagtactcgctcacacagcacttgtcgaacaacctcatcgatctg
tacattaacttgccgtcaagcaaccgcttccgtcgaccagccaactacatgagccgagga
taccaaacccgtcgcatggctgtcgactaccagactcctttggtgaccaacgtgaagaat
gccaagttgctaatcgaggccatcgctcgccactacgatatggagatcagtaaggtggac
ttccaggagttcgctgctgcgcccggagcacatgacgagtcatctgggcacatgtccagg
ctgaacgcctcattgtctctgtcacagctcctggcaaagtctccattcaagagggaacac
atcacttcggtcaagcaattcacccgagccgacctccatctgctattcactattgcccag
gaaatgcgtctcggtactcaacgccagggttgccttgatatcctcaagggccgcgtcctc
tgcactatgttctgtgagccatctaccaggacatctgcttccttcgacgctgctatgaag
cgccttggtggtgaagtaattgtcatcaacgagtcggtgtcttccacgcaaaagggcgag
tccgttgcggacactatccgcaccctgggctgctacggcgatgctattgttctgcgtcac
ccgtctgaggagtctatcgacattgctaccaagttctctgatgtgcccgtcatcaacgca
ggtaacggcagccgcgaacatccaacacaggcccttctcgacatcttcaccattcgtgag
gaacttggaactgtcaatggcctcaacatcaccttcgttggtgatctcaagtacggccgc
acagtgcactctctctgcgaacttctttctcactacgacgtcaccattaaccttgtctcg
cctgcgtctcttccgatgccttccggcgtcacggacgcgctcaaggctcgcggacaactc
aacaaggtatcaactgagttgaccgaagacattgtcgcctcttcggatgtcatgtactgc
actcgcgtccagaaggagcgcttccccgatgtggcaacgtatgaggcagtcaaggattcc
ttcgtcattgacaacaagctgttgaagggggccaaggcgaacatgattgtcatgcacccg
ctgccgaggaataacgagattaacgaggaggtggactttgaccccagggcagcgtacttt
agacagatgcggtacggactgtacacgcgtatggcgctgcttgcaatggttatggcgccc
tag

DBGET integrated database retrieval system