KEGG   Pyrenophora teres: PTT_17725Help
Entry
PTT_17725         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pte  Pyrenophora teres
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pte00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 372 aa AA seqDB search
MALKPLIISFVSLARAREITFPPVSGYASQQVIPQGFMEPDVTQAKFAGLNTYGNLPYVH
CLAPQGQEVEPFDIAILGAPFDTGVTARPGARFGPSGIRQGSRRIAPEAGWNIYTGENVL
LDWAKIIDCGDAPLTVLDNTAALKQLDKAHEIISARRTNSSEHTTPKIVSLGGDHTTTLS
ALRSVHHHFGPVSVIHFDSHLDTWDPEVLGGGISHYAGVNHGTFLHIAHEEGLIRNTSIH
AGIRAPVIRPKGDLRNDRRCGFEILKAREIDRFGVSGVIERLKSRVAGTKVYISVDIDVL
DPAFAPATGTSEVGGWSTRELLSILDGLEGLDVVGADVVEVAPVYDNPGEVTVLAAAEIV
LSLIGLMVKAPA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcactcaaacctttgattatatcattcgtatccttggcacgcgctcgcgaaatcacg
ttcccgcccgtttccgggtacgcgtcgcagcaggttatcccccaagggtttatggaaccg
gatgtcacgcaagcaaagttcgcggggttgaatacatatggcaatctgccgtatgtacat
tgtctagcgccccaaggccaggaagtggaacctttcgatattgcgatccttggtgcgcca
ttcgacactggcgttacggcaagaccaggagcgcgtttcggaccgagtggaatacgacag
ggatcgaggcgcattgcaccagaggctgggtggaatatctatacaggagagaacgtgctg
cttgattgggccaagataatcgactgtggcgatgctccgttgaccgtcctggataacaca
gcagctctcaagcagctcgacaaagcccatgagattatatcggcaagacgtaccaattcg
agcgagcatactacacccaagatcgttagtctgggtggtgatcataccaccacgttatct
gctttgcgatcagtccatcatcatttcggtcctgtgagcgtgatacactttgacagccat
ctagatacttgggacccggaagttttaggcggaggtatttcccattacgctggtgtaaat
catggcactttcttgcacatagcccacgaagaaggcttgatccgtaacacttcgattcac
gctggtatccgagcgcccgtaatacgaccaaaaggcgatttgcgaaacgatcgtagatgt
ggtttcgagattttgaaggcaagagaaatcgatcgtttcggtgtatctggagtaatcgag
agactgaagtctcgtgtggccggtacaaaggtctatatcagtgtggatatagatgttctt
gacccggcgtttgcacctgccacgggtacctctgaagtcggcggttggagtacacgagag
ctactttccattctggatggtctcgaaggattggatgttgttggagcagacgttgttgag
gtagcccctgtttatgacaatccgggtgaggtcaccgtcttggctgctgcagagatcgtc
ctgtcccttatcggactgatggtgaaagcaccagcttag

DBGET integrated database retrieval system