KEGG   Pyrenophora teres: PTT_17751Help
Entry
PTT_17751         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
pte  Pyrenophora teres
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PTT_17751
   00240 Pyrimidine metabolism
    PTT_17751
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PTT_17751
   03410 Base excision repair
    PTT_17751
   03420 Nucleotide excision repair
    PTT_17751
   03430 Mismatch repair
    PTT_17751
   03440 Homologous recombination
    PTT_17751
DNA repair and recombination proteins [BR:pte03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      PTT_17751
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 200 aa AA seqDB search
MPPKRKVTGPVAKSQQSTLAFHGSSNKVTKSGIKAPDAKQNIVEAKTKHVEPEIVQVSET
EPTTMEVAIIEQTEQEVKAQQAESTPEEDGARRISDAAIKKYWAAKEKQRLAPRVHQGDL
SLHDKMLREFDMSAHYGPCTGIARLKRWKRAQRLNLDPPIEVLAVLLREQDAADDKDLDR
LASQRSVVDELLNAKAEMDG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaaacgtaaagtaaccggccccgtagccaagtcgcagcagtcgacgcttgcg
ttccacggctcgtcgaacaaggtcaccaagtcgggcatcaaagcaccagacgcaaagcaa
aacatagtcgaagcgaagacgaagcatgtcgagccagaaattgtccaagtatcagaaacc
gagcccacgaccatggaagtagccataatcgagcaaacggagcaggaggtcaaggcgcag
caagcagagagcacaccggaggaagatggagcgcggcgcatatccgatgcagccatcaag
aaatactgggccgcgaaagagaagcagcggttagcgccgagagtgcaccagggagatctg
agccttcacgataagatgcttcgcgagttcgacatgagcgcccactatgggccatgcaca
ggcatcgctcgattgaagcgttggaagcgcgcgcaacggctcaatctcgacccaccgatc
gaagtgctcgctgttctgttgagggaacaggatgctgcggatgacaaggacttggacagg
ctggctagtcagcggtcggttgtggacgagttgctaaacgcgaaggccgagatggatgga
tga

DBGET integrated database retrieval system