KEGG   Pyrenophora teres: PTT_17968Help
Entry
PTT_17968         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pte  Pyrenophora teres
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 422 aa AA seqDB search
MRAIRARYDPYEQARGRVDQIKSLGHSVDKVEYIIMGGTFMSLPESYRDEFISQLHNALS
GYQTTDVDEAVAAGEMSNIKCVGITIETRPDYCLDQHLSSMLRYGCTRLEIGVQSLYEDV
ARDTNRGHTVSAVAKTFCLAKDAGFKVVSHMMPDLPNVGMERDLDQFVEYFSNPSFRTDG
LKIYPTLVIRGTGLYELWRTGRYKNYTPNALIDIVARILALVPPWTRIYRVQRDIPMPLV
TSGVENGNLRELALARMKDFGTTCRDVRTREVGINEVKHKIRPDQVELVRRDYTANGGWE
TFLAYEDPKQDILIALLRLRQCSKEHTFREELVGQPSSLVRELHVYGSAVPIHARDPKRF
QHQGYGTLLMEEAERIAREEHGSSKISVISGVGVRSYYAKLGYWLDGPYMSKTLEPLWER
EW
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccatccgcgcacgctacgacccgtacgagcaagcccgtggccgtgtagaccaa
ataaagtctctcggccacagcgtggacaaggtagagtacatcatcatgggcggcaccttc
atgtcgctcccagagtcgtaccgagacgaattcatatcgcaactgcacaacgccctctct
ggctaccaaaccaccgacgtcgacgaagcagtcgccgccggcgaaatgagcaacatcaaa
tgcgttggcatcacaatcgaaacgcgcccagactactgcctagaccaacatctctcctcg
atgctgcgctacggctgcacccgcctggaaatcggcgtccagtccctctacgaagacgta
gcccgcgacaccaaccgcggccacaccgtgtccgccgtggcaaaaaccttttgcctcgca
aaggacgcaggcttcaaagtagtatcacacatgatgccggacctgcccaacgtaggaatg
gagcgcgacctcgaccaattcgtcgaatacttctcaaacccctcgttccgcaccgacggc
ctgaaaatctaccccacgctcgtgatccgcggaacagggctgtacgaactctggcgtacg
ggccggtacaagaattataccccaaatgccctcatcgacatcgtcgctaggatcctcgcc
ctcgtcccgccctggacgcgcatctaccgcgtccagcgcgacatccccatgccgctggtt
acgtccggcgtggaaaacggtaatctgcgtgaactagctctcgctcgcatgaaggacttt
ggcacgacttgccgcgacgtgcgcacgcgcgaggtcggcatcaacgaggttaaacacaag
atccgccccgaccaggtcgaactcgtacgcagggactacacggcaaacggcgggtgggag
acttttctcgcctacgaggatccaaagcaggatattttgattgccttgttgaggctacgg
cagtgttccaaggagcatacgtttagggaggagttggtggggcagccgtcgtcgttggtg
agggaactgcatgtttatgggtctgcggttccgattcatgcgagggatccaaagaggttt
cagcatcaggggtatgggactttgttgatggaggaggcggagaggattgcgagggaggag
catgggagcagcaagattagtgtgatttcaggcgtgggagtgaggagttattatgccaag
ttggggtattggctcgatgggccgtatatgagtaagacgcttgagccgctgtgggagagg
gagtggtag

DBGET integrated database retrieval system