KEGG   Pyrenophora teres: PTT_18007Help
Entry
PTT_18007         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pte  Pyrenophora teres
Brite
Enzymes [BR:pte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     PTT_18007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 413 aa AA seqDB search
MHFTSSPLYFAVVGLSSSSAVLAGVLPYAQCGGKTFKGDSTCAEGWSCVKINDWYSQCVP
VPACTAGPTAPTFNATLPVATPAAVVSPTPAASPANNSAPAPNVAGNGANGAKCNLDAVM
KAKGKKYLGVATDQGLLTRDKNADIVKANFGCVTPENSMKWDATEGTQGQFTLSGANYLV
DFATKNDKLVRGHTTVWHSQLPTWVSSITDKTKLTEVMVAHIKKLMTTYAGKVYAWDVVN
EIFAEEGGFRSSVFYNVLGEDFVATAFAAAKAADPEAKLYINDYNLDSPSYAKTKAMASH
VKKWIAAGVPIDGIGSQSHLSGVWPMSDVPAAMELLCGSAPECAMTELDIKGGAAKDYKT
AFDACLNQKNCVGVTIWGVSDKTSWIGAAATPLLFDNSFQAKPAYNELCSALA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcactagctcccctctctacttcgccgtcgttggcttatcatcctcatctgct
gtccttgcaggtgtcctgccctacgcacaatgcggtggcaagaccttcaagggtgatagc
acctgcgctgagggctggtcttgtgtcaagatcaacgactggtacagccagtgtgttcca
gttcctgcttgcactgctggcccgactgccccgaccttcaacgccactctcccagtcgcc
acgcctgctgcggttgtctcgcccacacctgctgcctctcccgccaacaactctgccccc
gcacccaacgttgccggcaacggcgccaacggcgccaagtgcaacctcgatgccgtcatg
aaggccaagggtaagaagtaccttggtgtcgccaccgaccaaggcctcctcacccgcgac
aagaacgccgacatcgtcaaggccaactttggttgcgtcacccctgagaacagcatgaag
tgggatgccaccgaaggcacccagggccaattcaccctttccggtgccaactacctcgtc
gactttgctaccaagaatgacaagctggtccgtggccacaccaccgtctggcactcgcaa
ctccctacctgggtctcctccatcaccgacaagaccaagctcaccgaggtcatggtcgcc
catatcaagaagctcatgaccacctacgccggcaaggtctacgcctgggacgtagtcaac
gagatcttcgccgaagaaggcggtttccgctcctcagtcttctacaatgttctcggcgaa
gactttgtcgctaccgccttcgcagctgccaaagccgccgacccagaggctaaactctac
atcaacgactacaaccttgacagccccagctacgcaaagacaaaggccatggcatcccac
gtcaagaagtggatcgctgctggtgttcccatcgacggcatcggctcccagtcccatctt
tctggcgtctggcccatgtctgatgttcctgctgctatggagcttctctgcggttccgcc
cccgaatgcgcaatgactgagctcgacatcaagggtggagcggcaaaggactacaagact
gcctttgacgcttgcctgaaccagaagaactgtgtcggtgttaccatttggggtgttagc
gacaagacctcatggattggcgctgctgctaccccgttgttgttcgataatagcttccag
gctaagcctgcttacaacgagctttgctcggcgcttgcttaa

DBGET integrated database retrieval system