KEGG   Pyrenophora teres: PTT_18237Help
Entry
PTT_18237         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pte  Pyrenophora teres
Brite
Enzymes [BR:pte01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PTT_18237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 222 aa AA seqDB search
MAWRSHGTSNETLVQNLAKNNLIKSDRVKDAMLKVDRAHYAPATPYEDCPQPIGHRATIS
APHMHASACESLLDYLQPGSKVLDIGSGSGYLTAVLANLVAPNGSVVGIDHIQPLVDMGK
QNMQKSEEGRCMLDSGQVKFVLGDGRKGWAEGAPYDAIHVGAAAAEHHQILTDQLKAPGR
LFVPVQEGGLQYIFVIDKKEDGSLVRNKLYGVRYVPLTDAPV
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcgaagtcacggtaccagcaacgaaactctggttcagaacctcgccaaaaac
aatctcatcaagtcggaccgcgtcaaagatgccatgctaaaggtcgaccgcgcacactac
gcccccgccaccccctacgaagactgtccccaacccatcggccaccgcgctactatctcc
gccccacacatgcacgcctcagcctgcgaatcccttctcgactacctgcaacccggctcc
aaggtccttgacataggttctggatctggctacctgaccgccgttctcgccaacctcgtc
gctccgaacggctccgtcgtcggcatcgatcacatacagccgcttgtcgacatggggaaa
cagaatatgcagaagtcagaggaaggaagatgcatgctggactcggggcaggttaagttt
gtgttgggggatgggaggaaagggtgggccgagggcgcgccgtatgatgctattcatgtt
ggcgcggctgcggccgaacaccatcagattttgacggatcagttgaaggcgccggggagg
ctgtttgtgcctgtccaggagggcggtttgcagtatatctttgtgattgataagaaagag
gatgggagtttggtgaggaataagctgtatggtgtccggtatgtgccgttgaccgatgcg
cctgtgtga

DBGET integrated database retrieval system