KEGG   Pyrenophora teres: PTT_18292Help
Entry
PTT_18292         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pte  Pyrenophora teres
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PTT_18292
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PTT_18292
Enzymes [BR:pte01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PTT_18292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 168 aa AA seqDB search
MASATNFYEFKPKDKKGAVYDLSKLNGKVVLVVNTASKCGFTPQFEGLEKLYKEIKAAHP
NDFEILGFPCNQFGGQDPGSNEEIQEFCQLNYGVSFPVLGKIDVNGATADPAFEWLKNEK
PGLMGLKRVKWNFEKFLVGRDGKVKGRWASTKKPEDLKAEIEKELNNK
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggcatcagcaacgaacttttacgagtttaagccaaaggacaagaaaggtgccgtctac
gacctctccaagctcaacggcaaagtcgtcctcgtcgttaacacggcctcaaaatgcggt
ttcactccgcaattcgagggcctcgagaagctctacaaggaaatcaaggctgcacaccca
aacgactttgagattctaggtttcccttgcaaccaattcggtggccaggacccgggttcc
aacgaggaaattcaggagttttgccagttgaactacggtgttagcttccccgtgttgggc
aagattgatgtcaacggcgcaaccgcagaccccgctttcgaatggctcaagaacgagaag
ccaggcctcatgggcttgaagcgtgtcaagtggaactttgaaaagttcttggttggacgg
gatggcaaggtcaagggcaggtgggcgagcacaaagaagcccgaggatctcaaggcggag
attgagaaggagttgaacaacaagtaa

DBGET integrated database retrieval system