KEGG   Pyrenophora teres: PTT_18334Help
Entry
PTT_18334         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
pte  Pyrenophora teres
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 680 aa AA seqDB search
MSTPSTATATLPPHHQFYSHHQTYQSNISNAQIANGSGRIGNSLYNGYASGTSNSDLRRT
TATHSRQQQPPPQLPPITQPSPIDMSANDSGSAQRRRNPDWADFYKNGIPREVIVIDDDD
DDDEPQPPPPRQPGSARTAQTASARHTDKKRKTAASTAYDPVYNQHTSYSTTQTPYYDSP
NHSLSTDRTTSALHTTAHTSLGSQASNDHHISHLDNSAAGQKRKRTRAVVQDEAKQAKRR
ELADHDDPFSLYQPPPNPVIKAKDVHVQIIPDKSYTKDQKVDDEDGHYIVVPDADLTERY
QITKLLGQGTFGKVVQAYDRRKGTNCAIKVIRSVPKYRDASRIELRVLSTLASNDKHNIN
RCIHLRDCFDFRNHICIVTDLYGQSVFDFLKSNGFVPFPSSHIQKFAKQLFTSVAFLHDL
NLIHTDLKPENILLVNNNYQTFTYNRTVPSSSTTINRTARHRKVLLDPEIRLIDFGSATF
NDEYHSSVVSTRHYRAPEIILNLGWSFPCDIWSIGCILVEFFTGDALFQTHDNLEHLAMM
EAVCSGKIDRDIVRAVYKQDRGSSRNSTSSAARYFKNYKLDYPNAETNKASRKYVKAMKK
LPETIPAHTDFNRQFLDLLRRIFVYDPKKRITAKEALQHPWFKESLMDDGTEAHKIRLER
EKKARRMEEDRRYREQQRAY
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgccctcgaccgccacggccacactcccgccccatcaccagttttattcacac
caccagacgtaccaatccaacatctccaatgcccagatcgcaaacgggtctggtcggata
ggcaattcgctctacaacggctacgctagcggcacctcgaattcagacctgcgccgaacc
acagccacgcactcacgacaacaacaaccaccaccccagctgccgcccatcacacagccg
tccccgatcgacatgagcgcaaacgactccggctcggcccagcggcggcgcaatcccgac
tgggccgacttctacaagaacggcatcccgagggaggttatcgtgattgacgacgacgac
gacgatgatgagccccagccccctccgccgcgccagccaggctcggcacgcaccgcccaa
accgcatcggcacgccataccgacaagaagcgcaagacggccgcgtcgacggcctacgat
cccgtctacaaccagcacacgtcctactcgaccacccaaacaccctactacgactcgccc
aaccactccctgtctacggaccggaccacgtctgccctgcacactactgcgcacacgtca
ttgggctcgcaggccagcaacgaccaccacatctcgcatctcgacaactcggcggctggc
cagaagcgcaaacgcacccgcgccgtagtacaggacgaagccaaacaggccaagagacga
gagctggcagaccatgacgaccccttcagtctgtaccagccgcctcctaacccagtcatc
aaggcaaaggacgtgcacgtgcagatcatcccagataaatcctacaccaaggaccagaag
gtagatgacgaagacggccactacattgtagtgcccgatgccgacctcacagagcgatat
caaattacgaagctgctcggccagggcacctttggcaaagtcgtccaggcctacgacagg
cgcaagggtaccaattgtgccatcaaggtcatccgatcagtacccaaataccgggatgcc
agccgcatcgagctgagggtattgtcaacactggcatccaacgacaagcacaacatcaac
cgatgtatacatctgcgagactgcttcgacttccgaaaccacatctgcatcgtcaccgat
ctgtacggccaaagtgtctttgacttcctcaagtccaacggcttcgttcccttccccagc
tcccacatccaaaagtttgcaaagcagcttttcaccagtgtcgcgtttttacatgacctt
aacctcatccatacagatctgaaaccagagaatattcttcttgtcaataacaattatcaa
accttcacgtacaatagaactgtaccctcgtcttcgactacaatcaaccggacggctaga
catcgcaaggtccttcttgacccggagattagactcatcgactttggatcagcgacgttc
aacgacgagtatcattcttcagttgtatcaactcgtcattaccgagcacctgagatcatc
cttaatcttggctggagtttcccatgcgacatctggagcataggctgcattctagtcgag
ttcttcaccggcgatgctttgttccagacacacgacaatcttgaacatttagccatgatg
gaggctgtctgcagcggcaagattgatcgggacattgtgcgtgccgtctacaagcaagac
cgcggctcatcacgcaactcgacgagctccgccgcgagatacttcaagaactacaagtta
gactaccccaatgcggagaccaacaaggcgtccaggaaatacgtcaaggcgatgaagaag
ctacccgaaactatacccgcgcacacggacttcaacaggcagtttttggacctgttgagg
cggatattcgtctacgacccaaagaagcgcatcacggccaaggaagcattgcaacaccct
tggttcaaggaatcactcatggacgacggaaccgaagcgcacaagatccgactggagcgg
gaaaagaaggcgcgccgaatggaagaggatcgtcgttaccgtgaacaacagcgagcgtat
tga

DBGET integrated database retrieval system