KEGG   Pyrenophora teres: PTT_18336Help
Entry
PTT_18336         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
pte  Pyrenophora teres
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PTT_18336
Enzymes [BR:pte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     PTT_18336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 827 aa AA seqDB search
MADPSNWQPPPQSGGPLRSDHSAPLRSTALEHGSSPRSTKVVSFPDDNTISPLMIGKNKE
LDQKDYLDLDRPARQHTTSISKKRLTARSSTERLVPSKAPTTEGNPSLSSLLSDSSTDVG
SHSQHAHENLLKQVGTWLKHERSRRHARRAKRKAAKEGDASHEQSEGAASEATDQPIPRP
RSDSDSSQGEDSLNQLATILEKTLSMKLADAKRRPGNSSRNSTGLKRHSAISLDADYFES
VDQLVPSCEAILDNSKTMAYNVDLPGAESVPEVSEKEARKEREAWTKFRAEILRLAHTLK
LKGWRKVPMELSNEIDVQRLSGALTNAVYVVSPPKNLPAQEQNEDGPPKPRNPPPKLLLR
IYGPQVEHLIDRESELQILTRLARKRIGPRLLGTFTNGRFEEFLHAKPLTSKELRNADTS
KQIAKRMRELHEGIDLLKEEREAGPFVWQNWDKWVERCEYIVTWLDQQIREAKQNATQLS
SDKWKKLGYVCGTEWPVFRQMIEKYRRWLEEQYGGIDKINERMIFAHNDTQYGNILRMVP
EGESPLLLPANQHKQLVVIDFEYANANLPGLEFANHFTEWTYNYHDADVPWRCNTKYYPT
IEEQHRFIRAYLMHNPSYKASGGYTSNPATPHLGPLPSTGSTTALTATAAPTNISAFMLD
SRAPPGEKYQEQELQSERQIEEETRRLLAETKLWRLANSAMWVAWGIVQAHVPGLPDFDA
EEKKAAKIQNEEAAILDGATAEIKAEAEAEKQGAGIVSEEMAEQRELQTQAEQDADLFKP
QDEEEFDYLAYANDRAMFVWGDALRMGMVNMKDLPEELQSRVKLVEY
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atggccgacccctccaattggcagccgccgccgcagtctggtggcccactgcgaagcgac
cattccgcccctttgcgcagcactgccttggagcatggctcgtcaccacgttcgaccaaa
gtcgtgtcttttcccgatgataataccatctcgccattgatgattggcaagaacaaggaa
cttgaccaaaaagactatttggaccttgataggcctgctagacaacacactacaagcatc
agcaagaagcgattgactgcacgctcctcaactgaacgcttggttccaagtaaagccccc
actaccgaaggcaatccatccttgtcttcgttgctttcggacagctcgacagatgtcggg
tcgcacagtcagcatgcgcacgaaaacctgctgaaacaggtcggcacatggttgaagcac
gagcgaagcaggcgtcatgctcgtcgggcaaaacgcaaggctgccaaagaaggcgatgct
tctcatgaacagtcagaaggcgctgccagtgaagcaaccgatcaacctatacctcgaccc
agaagcgactccgattcctctcaaggtgaagactccctgaatcaattggccaccatcctg
gagaagactctatctatgaagctagccgacgcgaagagaaggcctggtaattcgtctaga
aactcgacgggtttgaaacggcattctgcaatttccctcgatgcagactacttcgagtcg
gtagatcagctcgttccgagttgtgaggccattttggataactcaaagaccatggcatac
aacgtcgacttgcccggggctgaatccgttcctgaagtatctgagaaagaagcacgtaaa
gagagagaggcttggaccaagttccgagccgagatcctccgtctagcccatactctcaaa
ctgaagggatggcgaaaggtgcctatggagctgagcaacgagattgacgtacagagatta
agtggtgcattgacaaatgccgtatatgttgtctcgcctcccaagaacttaccagcacag
gagcagaatgaggacggtccccccaaacccaggaatcctccacccaaacttctcctacgc
atctacggtccacaggtggaacacctgattgatcgagagtctgagttgcagattctgaca
cgacttgctcgcaagcgcatcggtccgcgtctgcttggtaccttcaccaacggacgattt
gaggagtttctccatgcgaagccgctcacgtccaaagagttgcgcaacgcagacacctcg
aagcagattgcaaagcgtatgcgagagcttcatgagggcattgatctacttaaagaggag
cgagaagctggcccatttgtttggcagaactgggacaagtgggttgagcgctgcgaatac
atcgtcacttggctcgatcagcagatccgcgaggccaagcagaacgcaacgcaattatct
tccgacaaatggaagaagctaggatatgtctgcggtaccgagtggccagtctttagacaa
atgattgagaaatatcgaaggtggttggaggagcagtatggcgggattgacaagatcaac
gagcgaatgatctttgcacacaacgatacccagtacggaaacattctacgtatggtgcca
gaaggcgagtcgcccctgctgcttccggcaaaccagcacaagcagctggtggtcatcgat
ttcgagtacgcaaacgcaaaccttcccggtctcgagtttgcgaatcacttcactgaatgg
acatacaactaccacgacgcagatgttccttggcgctgcaacaccaagtactatccaacc
attgaggagcagcataggttcattcgagcgtatctgatgcacaatccttcatacaaagca
tctggtggttacacatcaaaccctgcgaccccgcatctcggcccactcccctcgacaggt
agcacgactgccctaactgctactgcagcccctaccaatatttctgcgttcatgcttgac
tcgcgagctccacccggcgagaagtatcaggaacaggaattgcagtccgaacgccagatc
gaagaagagacacgccgtctgctagccgagacaaagctttggcgtctggcgaactctgca
atgtgggttgcttggggtatagttcaagctcacgtgcccggccttcccgacttcgacgcc
gaggagaagaaggcagccaagatccagaatgaggaggcggccatattggacggtgccaca
gcagagatcaaggcggaggcagaagcagagaagcagggggcagggatcgtgagtgaagaa
atggctgagcaaagagaactacagacacaagcggaacaagatgctgacctattcaagccg
caggatgaggaagagttcgattatcttgcttatgctaatgatcgcgccatgttcgtctgg
ggcgatgcgctacgcatgggtatggtgaacatgaaggacttgcctgaggagctgcagagc
agagtcaaacttgtggagtactaa

DBGET integrated database retrieval system