KEGG   Pyrenophora teres: PTT_18338Help
Entry
PTT_18338         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
pte  Pyrenophora teres
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:pte00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PTT_18338
Enzymes [BR:pte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     PTT_18338
Protein kinases [BR:pte01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   PTT_18338
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 675 aa AA seqDB search
MADSDPSTPDVQGDSDTVFDSPSPSPAPSSPPAPSSPKADTDAAFLSADRPPPRTASTTG
ATANMTSSSTPLGNINAARNPRPANPPTISSRGSGLNVSQDILARIQAVHLGRKGAPPTG
LPGRGPAPQSPGPSPNSNNPMSPPGGNMGGVPGNFRMPVRPPTTNFQSAPAVPGRAGGPK
PSMAERRGMNLGGFPGASPPGAPAGRKKPGLTLSQMNGDKPEDSAEPRKQETHFDKFSQF
VDTKTGSLKFAGKAILNSDGVQFASGSSFNISLDEVDTLDELGKGNYGTVYKVRHSRPRM
RKPGQGLAGNKAAPGSPSRKNFDEEPSLNGVPAAGTGIIMAMKEVRLELDDSKFAAIIME
LDVLHRCISPFIVDFYGAFFQEGAVYICMEFMDGGSIDKLYADGVPEGVLRKITMATTMG
LKSLKDEHNIIHRDVKPTNILMNTKGQIKICDFGVSGNLVASIAKTNIGCQSYMAPERIS
SGGIAQAGANPGGGTYSVQSDIWSLGLTIIECALGRYPYPPETYNNIFSQLSAIVDGEPP
DLPAEGYSDAARNFVRGCLNKIPNLRPTYAMLLQHAWLAPLAKPDTITEEEEEEVEAANE
AASGEAAGDQGPAEAIDMVEDKEVADWVKAAIEKRRSGKMKGAEKPALHAAPLDASVQSP
SPNGTNGLETAEVAA
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggccgactctgacccgtctaccccggacgtccagggcgattccgacaccgtcttcgat
agcccttcgccctctcctgcaccgtcttctcctcctgcgccctctagccccaaggccgac
accgatgccgccttcctgtccgccgaccgtcctccaccgcgaaccgcatccaccacaggc
gcgacggccaacatgacgtcttcgtcaacaccactaggcaacatcaatgctgcgagaaat
ccacgccctgcaaaccctcctaccatctccagcagaggcagcggtctcaacgtctcccaa
gatatcctggccaggatacaagcagtccatcttggccggaaaggcgccccgccaaccggc
ttgccaggaagagggcctgcgccccagagccctggtccgtcgcccaacagcaataatcca
atgtcgccgccaggcggaaacatgggaggtgtacctggcaacttccgaatgcctgtcaga
ccgccgacgaccaacttccagtcagctccagccgtccccggccgcgcaggcggccccaag
ccttccatggccgaacggcgtggcatgaatctcggtggctttccgggcgcgtctcccccg
ggcgctcctgctggcaggaagaagcccggcctgacgctctcgcaaatgaatggagacaag
cctgaagactcagcagagccgcgcaagcaagaaacccactttgacaagttttcccagttt
gtcgacaccaagaccggcagcctcaagttcgcgggcaaggctatactgaactcggacggt
gtacaattcgctagcggctcctccttcaacatctcgctagacgaagtcgatacgctagac
gaacttggcaagggcaactatggcacagtatacaaggtcagacatagcagaccacggatg
cgaaaaccgggacagggcctcgcaggaaacaaggctgctccaggctcgccgtcgcgaaag
aactttgacgaagaaccgagcctcaacggcgtgcctgccgcaggcaccggcatcatcatg
gcaatgaaagaagtccggcttgaattggacgactcaaagtttgctgctatcatcatggag
ctggatgtcctccatcgctgtatatcacccttcatcgtcgatttctacggcgccttcttc
caagaaggtgctgtgtacatatgcatggagttcatggacggtggttcgatagacaagctt
tacgccgacggtgtgcccgaaggcgtgctgcggaaaataaccatggcgacgactatgggt
ttgaagtcattaaaggatgagcacaacatcattcaccgcgacgtaaagcccaccaacatc
ttgatgaacaccaaaggacagatcaagatctgtgatttcggtgtcagcggcaacttggtg
gccagtattgccaagaccaacatcggatgccaaagttacatggcgcccgagaggatatct
tctggtggcattgcacaagcaggcgccaaccccggaggcggcacatacagcgtccaaagt
gacatctggagtcttggactgacgataatcgagtgcgctctgggacgatatccctacccc
ccagaaacgtacaacaacatcttcagtcaactcagtgcaattgtcgatggcgaaccgccg
gatctacctgcggagggatactctgatgcagcgcggaactttgtacgcggctgcttgaac
aagattcctaacctccgaccaacatacgccatgttgcttcaacatgcgtggcttgcacct
ctcgccaagccagacacaatcacagaagaggaagaggaagaagtggaagctgcaaatgaa
gcagctagtggtgaagcagctggcgaccagggccccgccgaagcaattgacatggtagaa
gacaaggaagtagcggactgggtaaaagccgccattgagaagaggaggagtggtaagatg
aagggcgcggaaaaaccggctctgcatgccgcacctttagatgcatcggtccaaagccct
tcgccaaacggtacaaacggactggaaactgcggaagttgctgcgtaa

DBGET integrated database retrieval system