KEGG   Pyrenophora teres: PTT_18347Help
Entry
PTT_18347         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
pte  Pyrenophora teres
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pte00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PTT_18347
Enzymes [BR:pte01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     PTT_18347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 890 aa AA seqDB search
MKPFRPLTLGRHHTGNGEPANKKRRISSNALSSTSRQPLNTLNNPAPAQFLPPGLEGDYY
TVLWRKYTTKKNKTWDGDGVLAVVGGHATLTDSDTGKELGKGACTRPLLPGSALSLGGKE
LEVEGSIEKADYLAGRMFLGTAAASPIEQSKRVEPGYKPLSSAKSKANKKSVAGESVPEY
KPSAQRNQQFKAPLLSNTVMPQRNLSIPQPRHDPHVPNALIMKRPDSCPKGKQIVDVVVD
PVLSKHLREHQRDGVQFLYECVMGMRCEGEGAIMADEMGLGKTLQTIALLWTLMKQNPIH
GASPVIKKALIVCPAGLVDNWKREFKKWLGNERIGVYVLDAKNKKIANFTMGKSYNILIV
GYEMLRVYQEELKKGSGVDIVIADEGHRLKTANNKAMLAIQSLNTERRIILSGTPLQNDL
GEFYTAIDFVNPGLLGQRAAFKRTFEAPIIRSRQPDASESELEKGEARWKELVSLTSRFM
IRRTAEVLSKYLPPKTEHIVFCRPTKGQAEAYRAILDSPTFRLAMGSSDIALQLINVLKK
ICNSPSLLKSSKDNDDTPSEMLQSILPLIPNNILNSSASSAKLRLLDSLVHRIYTTTEEK
IVIVSNYTTTLDMIERLLVSLSYTYLRLDGSTPASKRQALVEKFNKTPKTTSFAFLLSAK
SGGVGLNLIGASRIVLFDIDWNPATDLQAMARIHRDGQKLPCKVYRFLVQGGLDEKIYQR
QIMKMGLANAVVDNKASASSFSQEELRDLFRLDERDGCQTHDILGCMCGGQGTAEVNVAA
EEVISDDEDDIEDSDDGLYPTLTKASQVNMEEQEAKIQARRAAKLPKLRMLMEYRHIDTK
IFKEKTNREDDEDVDDIVDNMAVAIDDDVFLEVLREPECNVGFVLTKSTS
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgaagccattccggcctctgacacttgggcgccatcacactgggaacggtgagccagcc
aacaagaagcgacgcatctcatccaacgcactttcctcgacaagccgacagccgctcaat
acgctgaataacccagcgccggcacaatttctgcccccaggcctcgaaggggactactac
acagttttgtggcgaaagtacacgactaagaagaacaagacatgggatggtgacggcgtg
ctcgctgtcgtaggtggccatgccaccctcacagatagcgataccggaaaggagctgggc
aaaggagcgtgcacccgaccgctccttccgggttcagcgctttctcttggtggcaaagag
cttgaggtggagggctccattgaaaaggcggattatcttgctggacgtatgtttctgggc
actgctgcggcctcaccgatagagcagtcaaagcgcgtcgaaccaggatacaagcctcta
tcttccgccaaatcaaaggcgaacaagaaaagcgttgctggcgagagtgtgccagagtac
aagccctccgcgcaacgcaaccagcagttcaaagcgcccctattgtccaacacggtcatg
cctcagcgcaacctttcaataccacaaccccgtcacgatccacacgtaccgaatgccctc
attatgaagcgacctgactcttgtccgaaagggaaacaaattgtcgacgtagtcgtagac
cccgttctcagcaaacatctccgtgaacatcagcgcgatggcgtccagttcctctatgaa
tgcgtcatgggcatgcgatgtgagggcgaaggcgccatcatggctgacgagatgggcctg
ggaaagacactgcagactatcgcgctgctctggacgctaatgaagcagaacccgatccac
ggcgcctctcctgtcatcaaaaaagctctcattgtctgccccgctggtctggttgataac
tggaaacgcgagttcaaaaagtggctgggcaatgaaaggataggtgtttacgtgctggat
gcaaagaacaagaagattgccaactttaccatgggcaagtcctacaatattttgattgtc
gggtacgaaatgctgcgtgtttaccaggaagagctgaagaaaggtagtggcgttgatatc
gttattgcagatgagggtcacaggctgaagacggctaacaacaaggccatgcttgctatt
cagtccctaaacactgagcgacgcatcattttgtctggtactcctctacagaacgatttg
ggcgagttctacacggctatcgactttgtcaaccctggtctcttgggacaacgcgccgct
ttcaagcgaacatttgaagcacccatcattcgcagtcgtcagccagatgcgagcgagtct
gagttggaaaagggcgaggcacgatggaaagagctcgtatccctgactagtcggttcatg
atcagacggacagcagaagtgctttccaagtacctaccgccaaaaacggagcatatcgtc
ttctgcaggccgaccaagggccaggccgaggcctaccgcgcgatcctcgattctccgaca
ttcaggctcgccatgggaagttcagacatcgcattgcagctcatcaacgtgctgaagaag
atctgcaacagcccctccttgctcaaatcatcaaaggacaacgatgacacgccatcggag
atgcttcaaagcatcctgccgctcatcccgaacaacatcctcaattcgagtgcttcgagc
gccaagctgcgactgctcgacagcctcgtacatcgaatctacaccaccaccgaggagaag
attgtcatcgtctccaactacactaccactcttgacatgatcgagcgccttctggtatca
ctatcgtatacctacctccgtctcgacggtagtactcctgcctcaaaacgtcaagcactg
gtggaaaagttcaacaagaccccgaagaccacatcctttgcgttcctcctatccgctaaa
tctgggggtgtaggtctcaaccttatcggcgcatcgcgcattgtactcttcgatatcgat
tggaaccccgctacggatctgcaggccatggcgcgtatccaccgtgatggtcagaagctg
ccatgcaaagtgtacaggtttctggtacaaggcggtctagatgagaagatctaccaacgt
caaatcatgaagatggggcttgcgaatgccgtagttgataataaggcttctgcatcgtcg
ttttcgcaggaggagctaagggacttgttccgccttgatgagcgtgacggctgtcagaca
cacgacatcttaggctgtatgtgtggcggccaaggtacagcggaagtcaatgttgcagct
gaagaagtgatctcggatgatgaagatgacattgaagactcagatgacggtctttatccg
acactaacgaaagcgagccaagtcaacatggaggaacaagaagccaagatccaggccaga
agggctgccaaactacccaagttgaggatgctgatggagtatcgccatatcgatacgaaa
atcttcaaggaaaaaacaaatagggaagatgacgaagatgtggacgacattgtggacaac
atggccgtagccattgatgacgatgttttcctggaagtgctgagggagcctgagtgtaat
gtcggctttgtgctgacaaagtcgacgtcgtga

DBGET integrated database retrieval system