KEGG   Pyrenophora teres: PTT_18349Help
Entry
PTT_18349         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pte  Pyrenophora teres
Brite
Protein phosphatases and associated proteins [BR:pte01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     PTT_18349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4
Motif
Other DBs
NCBI-ProteinID: EFQ86423
UniProt: E3S6J0
Position
Unknown
AA seq 174 aa AA seqDB search
MGNQQSGLLDNIASGSNFDREEVDRLRKRFMKLDKDNSGTIERDEFLALPQISSNPLATR
MIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFRVYDIDRDGYISNGELFIVLK
MMVGSNLKDQQLQQIVDKTIMEADLDRDGKISFEEFTKMVENTDVSMSMTLDQF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaccaacagtcagggctactcgacaacatagcctccggttcgaatttcgaccgc
gaggaggtagaccgcctgcgaaagcgttttatgaagctggacaaggataactccggtacc
attgagcgcgacgagttcctagcccttccccaaatctcctccaaccctctcgcaacacgc
atgatcgccatcttcgacgaggatggtggcggcgacgtcgacttccaagaattcgtctct
ggcctctcagccttcagcagcaagggcaacaaggaggagaagctacggttcgcattccgc
gtatacgacattgaccgcgacggctacatcagcaacggcgagctcttcatagttctgaag
atgatggttggaagcaacttgaaggatcaacaactgcagcagatcgtcgacaagaccata
atggaggccgacctggaccgcgacggcaaaatcagtttcgaggagtttaccaagatggtc
gagaacacggatgtatctatgagcatgaccttggaccagttctag

DBGET integrated database retrieval system