KEGG   Pyrenophora teres: PTT_18564Help
Entry
PTT_18564         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
pte  Pyrenophora teres
Pathway
pte00860  Porphyrin and chlorophyll metabolism
pte01100  Metabolic pathways
pte01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PTT_18564
Enzymes [BR:pte01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PTT_18564
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     PTT_18564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 Pyr_redox_2 MCRA
Motif
Other DBs
NCBI-ProteinID: EFQ86251
UniProt: E3S700
Position
Unknown
AA seq 585 aa AA seqDB search
MRFQNVSQKTLKTVAVRPVLSSQSLFTCHRTRPLLASRHAPRLASQRRHHSTDPERIAVL
GGGIAGLSSAYYVGKQFPNSKITLFEAGNDPGGWIRTRRIDVKDADGKEGNVLFEQGPRA
LRPAPATAGLIQQLGLINDVTYTKRTDPGAMNRFIYYPDRLNCLPSTLPISFPHLYSLWR
TGMMAGLMGVLKEPWEKTRAAGLVDETVGSFFARRMDKRLADNLISAVFHGIYAGDVWQL
SVRTLLPSLWHLENIYGSVIGGFIKVQNEAVEDQRTTFVHEWDRNLMSKMQKEIDVDDGF
WTSLTQSTQFSLRNGLQQLVRALGDAVDKLGNVEVKTMSPIQSFKPLSEDGKLGVEVVSG
QQGSTSTESFDLAISTLREKDLTPYVTVMTINLYYPNPNLLPVEGFGYLIPQSVPFEQNP
ERGLGVIFDSSAIKGQDTVSGTKLTVMMGGHWWDGWQSYPTEEEGLEMAKSMLARHLNIT
DEPTAHFVNLAKDCIPQYTLGYQDRLTKFADKMSDEYKGRLRFVGSQFNGVGVNDCIASA
WNVAQQLQDGGWKGWSCGLDKVAHGDRWVVVPKNQMDFAMNKARG
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgcggttccagaatgtctcacagaagacgttgaagaccgttgccgtacgccccgtgctt
tcttctcaatcgctgttcacatgccaccgcacccgcccactactcgcatccagacatgcc
cctcgcctcgcctcgcaacgtcgccaccattccacagaccctgaacggatagccgtcctc
ggtggaggcattgctggtctcagtagcgcgtattatgtcggcaaacagtttcccaacagc
aagattaccctgtttgaggcgggcaacgacccaggtggatggattaggaccagacgcatt
gacgtcaaagatgccgacggaaaagaggggaatgtcttgttcgagcagggccccagggca
ttgaggcctgctcctgctacggcgggcttgatacaacaactgggcctcataaacgatgtc
acgtataccaagcgcactgatcccggcgccatgaaccgctttatatactaccctgatcgg
ctcaactgtctcccgtccacactgcctatcagctttccacacttgtattctctatggcgg
acggggatgatggccggcctcatgggcgtcctaaaggagccatgggaaaagacgcgagca
gcggggcttgtcgatgaaaccgtgggctccttcttcgcgcggagaatggacaaacggtta
gcagacaacctcatttctgcagtcttccatggcatctacgcaggcgacgtctggcagctc
agcgtaaggacattgctgcccagtctctggcatctagagaacatctatggcagcgttatt
ggcggctttatcaaagtgcagaatgaggccgtggaggaccaaaggaccacattcgtccat
gagtgggatagaaatctgatgtcgaagatgcagaaagagattgacgtcgacgacggcttt
tggacaagtctgacacagagtacacagttttcattgaggaatgggttgcaacagcttgta
cgggcattgggagatgcggtagacaagttgggaaacgtggaggtcaagaccatgtcgcca
attcagagcttcaaaccgctttctgaagacggcaaattgggcgtcgaagttgtgtctggg
caacaaggctcaacctcgacagagtctttcgatctcgccatctccacactccgcgaaaag
gatctcactccttacgttaccgtcatgactatcaatctctactaccccaaccccaacctc
ctccctgtcgaaggcttcggctatctcatcccgcaatccgtgccctttgagcaaaacccc
gagcgcggtctcggcgtcatcttcgactcctcagccatcaaaggccaagacacggtttcc
ggtaccaaactcactgtcatgatgggcggccactggtgggacggctggcaatcctacccc
accgaagaagagggcctagaaatggcaaagagcatgctagcccgacatttaaacatcacc
gacgaacctaccgcacattttgtcaacctcgccaaggattgcatcccgcaatacacactg
ggctaccaggaccgcctcaccaagtttgcggataagatgagtgacgagtacaagggtcga
ttgagatttgtaggcagccagttcaatggcgttggtgtcaatgattgtatagccagcgcg
tggaatgtggcgcaacagttgcaggatgggggatggaaggggtggagttgtgggctggat
aaggtggctcatggcgatcgctgggtcgttgtgccaaaaaatcagatggattttgcgatg
aacaaggcgagaggctga

DBGET integrated database retrieval system