KEGG   Pyrenophora teres: PTT_18564Help
Entry
PTT_18564         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pte  Pyrenophora teres
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PTT_18564
Enzymes [BR:pte01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PTT_18564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 585 aa AA seqDB search
MRFQNVSQKTLKTVAVRPVLSSQSLFTCHRTRPLLASRHAPRLASQRRHHSTDPERIAVL
GGGIAGLSSAYYVGKQFPNSKITLFEAGNDPGGWIRTRRIDVKDADGKEGNVLFEQGPRA
LRPAPATAGLIQQLGLINDVTYTKRTDPGAMNRFIYYPDRLNCLPSTLPISFPHLYSLWR
TGMMAGLMGVLKEPWEKTRAAGLVDETVGSFFARRMDKRLADNLISAVFHGIYAGDVWQL
SVRTLLPSLWHLENIYGSVIGGFIKVQNEAVEDQRTTFVHEWDRNLMSKMQKEIDVDDGF
WTSLTQSTQFSLRNGLQQLVRALGDAVDKLGNVEVKTMSPIQSFKPLSEDGKLGVEVVSG
QQGSTSTESFDLAISTLREKDLTPYVTVMTINLYYPNPNLLPVEGFGYLIPQSVPFEQNP
ERGLGVIFDSSAIKGQDTVSGTKLTVMMGGHWWDGWQSYPTEEEGLEMAKSMLARHLNIT
DEPTAHFVNLAKDCIPQYTLGYQDRLTKFADKMSDEYKGRLRFVGSQFNGVGVNDCIASA
WNVAQQLQDGGWKGWSCGLDKVAHGDRWVVVPKNQMDFAMNKARG
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgcggttccagaatgtctcacagaagacgttgaagaccgttgccgtacgccccgtgctt
tcttctcaatcgctgttcacatgccaccgcacccgcccactactcgcatccagacatgcc
cctcgcctcgcctcgcaacgtcgccaccattccacagaccctgaacggatagccgtcctc
ggtggaggcattgctggtctcagtagcgcgtattatgtcggcaaacagtttcccaacagc
aagattaccctgtttgaggcgggcaacgacccaggtggatggattaggaccagacgcatt
gacgtcaaagatgccgacggaaaagaggggaatgtcttgttcgagcagggccccagggca
ttgaggcctgctcctgctacggcgggcttgatacaacaactgggcctcataaacgatgtc
acgtataccaagcgcactgatcccggcgccatgaaccgctttatatactaccctgatcgg
ctcaactgtctcccgtccacactgcctatcagctttccacacttgtattctctatggcgg
acggggatgatggccggcctcatgggcgtcctaaaggagccatgggaaaagacgcgagca
gcggggcttgtcgatgaaaccgtgggctccttcttcgcgcggagaatggacaaacggtta
gcagacaacctcatttctgcagtcttccatggcatctacgcaggcgacgtctggcagctc
agcgtaaggacattgctgcccagtctctggcatctagagaacatctatggcagcgttatt
ggcggctttatcaaagtgcagaatgaggccgtggaggaccaaaggaccacattcgtccat
gagtgggatagaaatctgatgtcgaagatgcagaaagagattgacgtcgacgacggcttt
tggacaagtctgacacagagtacacagttttcattgaggaatgggttgcaacagcttgta
cgggcattgggagatgcggtagacaagttgggaaacgtggaggtcaagaccatgtcgcca
attcagagcttcaaaccgctttctgaagacggcaaattgggcgtcgaagttgtgtctggg
caacaaggctcaacctcgacagagtctttcgatctcgccatctccacactccgcgaaaag
gatctcactccttacgttaccgtcatgactatcaatctctactaccccaaccccaacctc
ctccctgtcgaaggcttcggctatctcatcccgcaatccgtgccctttgagcaaaacccc
gagcgcggtctcggcgtcatcttcgactcctcagccatcaaaggccaagacacggtttcc
ggtaccaaactcactgtcatgatgggcggccactggtgggacggctggcaatcctacccc
accgaagaagagggcctagaaatggcaaagagcatgctagcccgacatttaaacatcacc
gacgaacctaccgcacattttgtcaacctcgccaaggattgcatcccgcaatacacactg
ggctaccaggaccgcctcaccaagtttgcggataagatgagtgacgagtacaagggtcga
ttgagatttgtaggcagccagttcaatggcgttggtgtcaatgattgtatagccagcgcg
tggaatgtggcgcaacagttgcaggatgggggatggaaggggtggagttgtgggctggat
aaggtggctcatggcgatcgctgggtcgttgtgccaaaaaatcagatggattttgcgatg
aacaaggcgagaggctga

DBGET integrated database retrieval system