KEGG   Pyrenophora teres: PTT_18604Help
Entry
PTT_18604         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pte  Pyrenophora teres
Pathway
pte00010  Glycolysis / Gluconeogenesis
pte00052  Galactose metabolism
pte01100  Metabolic pathways
pte01110  Biosynthesis of secondary metabolites
pte01130  Biosynthesis of antibiotics
Module
pte_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTT_18604
   00052 Galactose metabolism
    PTT_18604
Enzymes [BR:pte01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PTT_18604
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: EFQ86233
UniProt: E3S738
Position
Unknown
AA seq 394 aa AA seqDB search
MRFSTLLPFFTAAALAQYSSAPNSTWTAGPDKDGKYEISSEGIRGHFIAYGASISNLFIQ
GKDGVERDIVLGFDNATAYEGKVHPHFGGVPGRYANRIKNSTFDIDGETFHIVPNENNKN
NTLHGGPDGWDYRNFTVVSHTKDSITFSIVDPDGKEGFPGEVVSYVTYTMTPNTWNIKIV
ALATTKKTPIMLTSHTYWNLDGFANPDDETALNHTFYMPYSGQRVGVDAILIPDGSILAN
EKYSVNDFWSSPKQIGANSSAPELLGNCGTNCTGYDNCYIVNRDQGEVLDWVNSGPVATL
SSKWSGIKLDIYTDQEAFQMYSCPGQDGTIPYKSTQGAKGGSGLVPKYGCIVMEVQDWID
AINQPAWMRDKKQIFGPSTGAFNLQAKYVFSKTN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcggttctccactctcctgccattctttacggccgctgcccttgcgcagtacagctct
gcgccaaactcgacttggactgctgggcctgacaaggacggcaagtacgaaatctcgtct
gagggcatccgtggtcactttattgcctacggcgcgtctatttccaacctctttatccag
ggcaaggacggcgtagagcgcgatattgtcctcggctttgacaacgcgaccgcttatgag
ggcaaggtccacccccactttggcggtgtaccaggtcgttacgccaatcgcatcaagaac
tcaacattcgacatcgatggcgagactttccacatcgtgccgaacgagaacaacaaaaac
aacactctgcacggcggaccagatgggtgggactaccgtaacttcaccgtcgtgtcgcac
actaaagactccatcaccttttccattgtcgaccctgatggcaaggagggctttccaggc
gaggttgtgagctacgttacttacaccatgacgccaaacacctggaacatcaagattgtg
gctcttgcaaccaccaagaaaacgcccatcatgctgacatcccacacctactggaacctg
gatggttttgccaaccccgacgacgagactgctctcaaccacactttctacatgccctac
tctggtcaacgtgtcggtgtagacgccattcttatccccgatggcagcattcttgcaaat
gaaaagtactcggtcaacgacttttggtcatctcccaagcagattggtgccaactctagt
gcgcctgagctactcggtaactgcggtaccaactgcactggttacgataattgctacatc
gtcaaccgcgaccaaggtgaagtcctcgactgggtcaactctggacccgtcgctaccttg
tctagcaagtggtctggcatcaagctggatatctacacagatcaagaggccttccagatg
tacagctgtcctggccaagatggcacgatcccctacaagtccactcaaggtgccaagggc
ggtagtggattggtccccaagtatggatgtatcgtgatggaggttcaggactggattgac
gctatcaaccagcctgcgtggatgcgggacaagaagcaaatctttggaccctccactggt
gccttcaaccttcaggcaaagtacgtcttttccaagaccaactaa

DBGET integrated database retrieval system