KEGG   Pyrenophora teres: PTT_18654Help
Entry
PTT_18654         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
pte  Pyrenophora teres
Brite
Exosome [BR:pte04147]
 Exosomal proteins
  Proteins found in most exosomes
   PTT_18654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 130 aa AA seqDB search
MSWQAYVDTSLVGSGNIDKAVICDVAGSGPWAASAGFDLSAAEMKAIADSFDDKSDPKSV
ISNGTKICGEKYMTIESSEDSLKAKKGKEGVVAYKTAQALIIAHHPEDVQTTNAYNTVVE
LGVYLKNAGY
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggcaagcatacgttgacacgagcctcgtcggcagcggcaacatcgacaaggcc
gtcatctgcgatgtagcaggctcaggcccatgggccgcctccgcaggctttgatcttagc
gctgctgagatgaaggccatcgccgactcattcgacgacaagtcagaccccaagtctgtc
atctccaacggtaccaagatatgcggcgagaagtacatgaccattgagtcaagcgaggac
tctctcaaggcaaagaagggtaaagaaggtgtcgtcgcctacaagaccgcccaagccctc
atcatcgcccaccacccagaagatgtccagaccaccaacgcctacaacaccgtcgtcgag
ctcggcgtttacctcaagaacgcaggatactaa

DBGET integrated database retrieval system