KEGG   Pyrenophora teres: PTT_19137Help
Entry
PTT_19137         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pte  Pyrenophora teres
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PTT_19137
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PTT_19137
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PTT_19137
Enzymes [BR:pte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PTT_19137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 546 aa AA seqDB search
MSSHTASQRYLSTRGGSYDFSFENVVLKGLASDGGLFIPEEIPTLPDDWASKWKDLSFED
LAFEIFSLYISSSEIPSADLKDIIHRSYSTFRTKDVAPTVPLDLKKNIHLLELFHGPTFA
FKDVALQFLGNLFEYFLVRKNEGKTGRDREHLTVIGATSGDTGSAAIYGLRGKKDVSVFI
MFPYGKVSPIQEAQMTTVMDANVHNLAVDGTFDDCQDFLKELFADPEINGTHRLAAVNSI
NWARILAQITYYFYSYFSLVKSESFLPASAVRFVVPTGNFGDILAGFFAKRMGLPVEKLV
IATNANDILQRFWESGKYEKHAVHGAQAEGGIPEDGAKAHVSGVKETLSPAMDVLVASNF
ERLLWFLSYDVYSSNSDAVSQRRSQAGDHVRNWLNDLKSKGGFSVDKQILEAAQADFVSY
RVSDEETIDTIKYVFNAESSKSYVLDPHSAIGIAATLRSVEVAKPPTTHHIALATAHPAK
FANAVELALPEHKEYFHEKVLPVEFKGLEDKPRRVSHVKKSEGFEGIRKVVIAEVEAERQ
AAENGA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgcacacagcatcacaacggtacctgagtacccggggaggatcttatgatttc
tctttcgaaaacgttgttctcaagggcctggcgtcagacggcggtctcttcatccccgag
gagatccctacgctgcctgacgactgggcatccaagtggaaagacctctcgttcgaagac
ctcgcattcgaaatcttctccctctacatctcatcgtccgagatcccctccgcagacctc
aaagacatcattcaccgcagttactccacattccgcacaaaggacgttgcgcccaccgtt
ccgctcgacctgaagaagaacatacacttgctagagttgttccacggacctacattcgct
ttcaaagatgtcgcattgcaattcttgggcaacctgttcgagtacttccttgtccgcaag
aatgagggaaagacgggacgagacagggagcatctgaccgtcatcggcgcaacaagtggt
gataccggctcagcagccatctacggtctgcgtgggaagaaggatgtgtctgtctttatc
atgttcccctatggcaaggtcagcccgatccaggaagcacagatgacgacggtcatggat
gccaatgtgcacaacttggccgtggacggcacattcgacgactgccaggacttcctgaaa
gaactctttgctgacccagagatcaacggaacgcaccgtctcgccgccgtgaactccatc
aactgggcacgtatccttgcgcagatcacctactatttctactcctacttcagcctcgtc
aaaagcgagtctttcctcccagcctccgctgttcgcttcgtcgtacctacgggcaacttc
ggcgatattcttgccggcttctttgcaaagcgcatgggcctgccggttgagaagctggtc
atagccacaaacgcaaacgacattctgcaacgcttctgggaatcaggcaagtacgagaag
cacgctgtgcacggtgcgcaagccgaaggcggaattcccgaagatggtgcaaaggcacac
gtgagtggagtcaaggagacgctgagcccggcaatggacgttcttgtggcgtccaacttt
gaaagactgctttggttcctgtcgtacgatgtatacagctcaaactcggacgcagtatca
caacgaaggagtcaggcgggtgaccacgtacggaattggctcaacgacctaaagtcaaag
ggtggcttttcggtcgataagcagattctggaagcagcacaggctgactttgtgtcgtat
cgtgtcagcgacgaggagaccatcgacaccatcaagtacgtgttcaacgcagagtcatca
aagagctacgtcctggacccccactccgccattggcattgcagcaacgcttcgttcagtt
gaggtagcgaagcccccaactacacatcatatcgcgcttgcgacggcacacccagccaag
tttgcgaatgcagtagaactcgcacttccagagcacaaggagtacttccacgagaaggtt
ttgcccgttgagttcaagggacttgaggataagccacgtagagtaagccacgtcaagaag
tcggaaggctttgaaggcatacgcaaggttgttattgcggaagtagaagcggaacgacaa
gccgcggaaaatggtgcatag

DBGET integrated database retrieval system