KEGG   Pyrenophora teres: PTT_19353Help
Entry
PTT_19353         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
pte  Pyrenophora teres
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pte00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PTT_19353
Enzymes [BR:pte01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PTT_19353
Exosome [BR:pte04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PTT_19353
  Exosomal proteins of colorectal cancer cells
   PTT_19353
  Exosomal proteins of bladder cancer cells
   PTT_19353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 541 aa AA seqDB search
MKYATVCATLFAALAGASDVKQLKTDNFKSFIEENDLVLAEFFAPWCGHCKALAPEYETA
ATTLKEKDIALVKVDCTEEQDLCQEYGVDGYPTLKVFRGLENISPYGGQRKADSLISYMT
KQALPAVSEITKDTLEEFKTADKVVLVAYFAADDKASNETFTSVANGLRDNYLFGATNDA
ALAKAEGVKQPGLVLYKSFDDGKDVFKEKFEADAIRDFAKVASTPLIGEVGPETYAGYMA
AGLPLAYIFAETQEERDEFAKVLKPLALKHKGKINFATIDAKSFGQHAGNLNLKVGTWPA
FAIQATEKNEKFPYDQEAKITEKDIGKFVDQYLAGKLEPSIKSEPVPEKNDGPVTTIVAH
NYKEVVLDNDKDVLVEFYAPWCGHCKALAPKYEELGQLYQTPEFSKLVTIAKVDATANDV
PDEIQGFPTIKLFAAGKKDAPVDYSGSRTIADLIEFVKENGSHKVSVVYTGSDEGMADKL
AHQAPAATEKDANSATDDTEKDDAASEATESVKSGAAAATDAAKDAASEASASASSVKDE
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgctacagtttgcgccaccctctttgcggcccttgcgggtgcgtccgatgtc
aagcagctcaagacggacaacttcaagagcttcattgaggagaacgacctcgttctcgct
gagttcttcgcaccgtggtgcggccattgcaaggctcttgcccccgagtacgagacggct
gccactacacttaaggagaaggacatcgctcttgtcaaggtcgactgcaccgaagagcag
gacctatgccaggagtacggtgtcgatggttaccccaccctcaaggtcttccgcggcctc
gagaatatctcgccgtacggcggtcaacgcaaggccgacagcttgatctcctacatgacc
aagcaggccctgcccgctgtctcggaaatcacaaaggacacccttgaggagttcaaaact
gccgacaaagttgtccttgtcgcctacttcgcggccgatgacaaggcctccaacgagaca
ttcacatcggtcgccaatggcctccgtgacaactacctcttcggagccaccaacgacgct
gcgctcgccaaggctgagggtgtcaagcagcccggccttgtcctctacaagtctttcgac
gacggcaaggatgtcttcaaggagaagtttgaggcggacgctatccgcgacttcgccaag
gttgcctctaccccgctcatcggcgaggtcggtcctgagacttacgctggatacatggcc
gctggccttcctcttgcatacatcttcgccgagactcaagaggagcgtgacgagttcgcc
aaggtgctcaagcctctcgctctcaagcacaagggcaagatcaacttcgccaccattgac
gccaagtctttcggccagcacgctggtaacctcaacctcaaggtcggcacatggcccgct
ttcgctatccaggctaccgagaagaacgagaagttcccctatgaccaagaggccaagatc
accgagaaggacattggcaagtttgtcgaccaatacctcgctggcaagctcgagcccagc
atcaagtctgagcccgtccccgaaaagaacgacggtcccgtcaccaccatcgttgcccac
aactacaaggaggtcgttcttgacaacgacaaggacgtcctcgttgagttttacgctcct
tggtgcggtcactgcaaggctcttgctcccaagtacgaggagctcggccagctttaccag
actcctgagttctccaagcttgtaaccatcgccaaggttgatgctactgccaacgacgtt
cccgatgaaattcagggtttccctaccatcaagctctttgccgctggcaagaaggacgcc
cctgtcgactactctggctcccgcactattgcggacctcattgagttcgtcaaggagaac
ggttcacataaggtctcggtcgtttacactggcagtgatgaaggtatggctgataaactt
gctcaccaggctcctgccgcaaccgagaaggatgctaattctgccacagatgataccgag
aaggacgatgctgcctcagaggctaccgagtctgtcaagtctggtgccgcagcggcgacc
gacgctgccaaggacgctgcatcagaggcctccgcgtctgcttcaagtgtcaaggatgag
ttgtag

DBGET integrated database retrieval system