KEGG   Pyrenophora teres: PTT_19353Help
Entry
PTT_19353         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
pte  Pyrenophora teres
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:pte04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 541 aa AA seqDB search
MKYATVCATLFAALAGASDVKQLKTDNFKSFIEENDLVLAEFFAPWCGHCKALAPEYETA
ATTLKEKDIALVKVDCTEEQDLCQEYGVDGYPTLKVFRGLENISPYGGQRKADSLISYMT
KQALPAVSEITKDTLEEFKTADKVVLVAYFAADDKASNETFTSVANGLRDNYLFGATNDA
ALAKAEGVKQPGLVLYKSFDDGKDVFKEKFEADAIRDFAKVASTPLIGEVGPETYAGYMA
AGLPLAYIFAETQEERDEFAKVLKPLALKHKGKINFATIDAKSFGQHAGNLNLKVGTWPA
FAIQATEKNEKFPYDQEAKITEKDIGKFVDQYLAGKLEPSIKSEPVPEKNDGPVTTIVAH
NYKEVVLDNDKDVLVEFYAPWCGHCKALAPKYEELGQLYQTPEFSKLVTIAKVDATANDV
PDEIQGFPTIKLFAAGKKDAPVDYSGSRTIADLIEFVKENGSHKVSVVYTGSDEGMADKL
AHQAPAATEKDANSATDDTEKDDAASEATESVKSGAAAATDAAKDAASEASASASSVKDE
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgctacagtttgcgccaccctctttgcggcccttgcgggtgcgtccgatgtc
aagcagctcaagacggacaacttcaagagcttcattgaggagaacgacctcgttctcgct
gagttcttcgcaccgtggtgcggccattgcaaggctcttgcccccgagtacgagacggct
gccactacacttaaggagaaggacatcgctcttgtcaaggtcgactgcaccgaagagcag
gacctatgccaggagtacggtgtcgatggttaccccaccctcaaggtcttccgcggcctc
gagaatatctcgccgtacggcggtcaacgcaaggccgacagcttgatctcctacatgacc
aagcaggccctgcccgctgtctcggaaatcacaaaggacacccttgaggagttcaaaact
gccgacaaagttgtccttgtcgcctacttcgcggccgatgacaaggcctccaacgagaca
ttcacatcggtcgccaatggcctccgtgacaactacctcttcggagccaccaacgacgct
gcgctcgccaaggctgagggtgtcaagcagcccggccttgtcctctacaagtctttcgac
gacggcaaggatgtcttcaaggagaagtttgaggcggacgctatccgcgacttcgccaag
gttgcctctaccccgctcatcggcgaggtcggtcctgagacttacgctggatacatggcc
gctggccttcctcttgcatacatcttcgccgagactcaagaggagcgtgacgagttcgcc
aaggtgctcaagcctctcgctctcaagcacaagggcaagatcaacttcgccaccattgac
gccaagtctttcggccagcacgctggtaacctcaacctcaaggtcggcacatggcccgct
ttcgctatccaggctaccgagaagaacgagaagttcccctatgaccaagaggccaagatc
accgagaaggacattggcaagtttgtcgaccaatacctcgctggcaagctcgagcccagc
atcaagtctgagcccgtccccgaaaagaacgacggtcccgtcaccaccatcgttgcccac
aactacaaggaggtcgttcttgacaacgacaaggacgtcctcgttgagttttacgctcct
tggtgcggtcactgcaaggctcttgctcccaagtacgaggagctcggccagctttaccag
actcctgagttctccaagcttgtaaccatcgccaaggttgatgctactgccaacgacgtt
cccgatgaaattcagggtttccctaccatcaagctctttgccgctggcaagaaggacgcc
cctgtcgactactctggctcccgcactattgcggacctcattgagttcgtcaaggagaac
ggttcacataaggtctcggtcgtttacactggcagtgatgaaggtatggctgataaactt
gctcaccaggctcctgccgcaaccgagaaggatgctaattctgccacagatgataccgag
aaggacgatgctgcctcagaggctaccgagtctgtcaagtctggtgccgcagcggcgacc
gacgctgccaaggacgctgcatcagaggcctccgcgtctgcttcaagtgtcaaggatgag
ttgtag

DBGET integrated database retrieval system