KEGG   Pyrenophora teres: PTT_19548Help
Entry
PTT_19548         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pte  Pyrenophora teres
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PTT_19548
  Lipid metabolism
   00561 Glycerolipid metabolism
    PTT_19548
   00600 Sphingolipid metabolism
    PTT_19548
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    PTT_19548
Enzymes [BR:pte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PTT_19548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 507 aa AA seqDB search
MSPSRSTVVAVTTLLSGATAISNGLAITPPMGWNNWNAFGCDVSENLLLTTSAQIVSLGL
RDLGYDYVVLDDCWQDPKGRDKKGKLQPALEKFPNGLNSISDHLHGQNLKFGMYSSAGEM
TCARFEGSLDHEVDDAKSFAGWGVDMLKYDSCYHMGRVGTPSVSFNRFKAMSDALKATGR
NILLNLCNWGEDLVHTWGMSISNSWRITGDIYDSFTRPDDLCGCNSLSPGDVNCVAPGTH
CSVVFILNKVAPFADRSIPGGWSDLDMLEVGQGGMTDEEYKAHFALWAALKSPLFLGNDL
RDMPASALTIINNPAIIALSQDPHGRSVTRVRRDTAGVAKDEWGVGETHVWAGHLQNGDE
AVILLNAGGEDMEMSVSLAEIFIPYGPGGSAPHVKYDWAIHDLWAHRMPESTAEALLAAA
NDSERASIMAKANWYNATEVPYAKGLTQGDARLFGEKIGVVKAGGILKADVKSHAARVFR
LRRIAKEGDGFEAKSISREDVNDKDEL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtctccctcacgtagcaccgtcgttgcggtaacgacactcttgagtggcgcaactgcc
atcagcaatggccttgctatcactcccccgatgggctggaacaactggaacgcattcggc
tgcgacgtctctgagaatctacttctcacaacctcggcacagatagtgagcttaggtctg
cgggatctaggatacgactatgttgtactggatgactgctggcaagatccgaaaggtcgc
gacaagaagggaaagcttcaaccagccttggaaaaattccccaatgggttgaactcaatc
tcagaccatctccatggccagaacttgaagtttggcatgtatagtagtgcgggcgagatg
acgtgcgcgagatttgagggatcacttgaccacgaggtcgatgatgctaagagcttcgct
gggtggggcgtagatatgttgaagtacgacagctgctatcacatgggccgtgttggtaca
ccctctgtatctttcaaccgcttcaaagcgatgtcggatgccttgaaagcgacagggaga
aacattttgctcaatttgtgcaactggggagaagatctggttcacacatggggaatgtct
atttctaattcatggcgtatcacgggagacatatacgattcgttcacgcggcctgatgat
ctctgtggttgcaatagcctttcaccaggcgatgtcaattgcgtagcacctggcacacat
tgctcagtcgtcttcattctaaacaaggttgccccctttgcagaccgtagcattcctggt
ggatggagcgatctcgatatgctcgaggttggacagggcggcatgactgacgaagaatac
aaagcgcatttcgcactctgggccgctctcaaatcgccgttgttccttggaaacgatctg
cgcgacatgccagcttccgcgcttaccatcattaacaatcctgccatcatcgcacttagt
caagatccccatggacggagtgtgacgcgcgtgcgaagggatacggcgggcgtagcaaag
gatgaatggggcgttggtgaaactcacgtctgggcaggacacctgcagaacggagatgaa
gctgtcatcctcttgaacgctggtggagaagacatggagatgagcgtctcccttgccgaa
attttcattccgtatgggcccggtggatcggcaccacacgtcaagtacgactgggccatc
catgatctttgggctcatcgcatgcccgaatcgaccgcagaagcactgctcgccgcggcg
aatgacagtgaaagagcatcgattatggcaaaggcaaactggtacaacgctacagaggtg
ccgtatgccaagggccttacgcaaggagatgcgcgactgtttggcgaaaagattggtgtg
gtcaaagcgggtggcattctcaaggcagacgtgaagagtcacgctgcgagagttttccgt
ttgcgaaggatagctaaggagggtgatggctttgaggcgaaaagcatttcaagagaggat
gttaacgacaaggacgaattgtag

DBGET integrated database retrieval system