KEGG   Pyrenophora teres: PTT_19951Help
Entry
PTT_19951         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
pte  Pyrenophora teres
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pte00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1520 aa AA seqDB search
MATPGTATSRSLADVSKAAVYNTAEALSNSVLGMKSADTTTPSTSFGLLGRVVLSIFSVL
PTILYWVTYTLPTWLFTLFSMSLTFTMSFTSLMLVVVFLVSTISWFVRYRYMTMYARLPP
EPQREEPQVEVFPDSAESDSKRGLSNYLDEFLSAIKVFGYLERPVFHELTRTMQTRRLVA
GETILLEEEKGFCLVVDGLVQIFVKSNRADSDSDEDDMGGTESGDSAQQGHGQGYQLLTE
VKNGAPMSSLFSILALFTEDVKLRHDEDPDTGPSIPGTPNGAQSRPSVSRTSSFALDNSR
PQSPREAPEARLRHRRTSTLNSPTAGGRLERVPPLSLDLEEFGNERLKNTKTRKSPSRPG
KPKSAHPDIVARATVDTTIAIIPATAFRRLTRIYPKATAHIVQVILTRLQRVTLATSHAY
LSLTNEVLRTEKLMNKYTTYDLPGFLRDAPLERLKEKFAKETERIGEDEGMKGIALHNPG
AGRRRRSSVSLRRGTAAQARLAAAREASATGTVGSVALPKMTSPDQGPRNDRISAGDLLT
NSQMARGAGRIGRSSFSQPYHQDRRDVRTPLDASSFNPFASPSLRPKTLHRQESIDEATV
FRESILGCMFKAIGLTNLETPMPRATASVEQSPQLVSFDAGRQKAVFTNAFGFIDPYAAS
RDGDTESVASASNLSGMGGMGSHNILEEIVSDVEIVFFPKDSVLVEQGERNPGLYYVIDG
FLDVSVQVEEASEKNVFGTAPNGNGCTEEELFGSPLKPTSSNTGGRPPVDGSKKKRTRRS
LFMTKPGGLAGYLGTVSSNRSFVDVTAKTDVYVGFLPRGSIEKIVERYPVVLLTMAKRLT
TLLPRLIQHIDFALEWVQVNAGQVIYNQGDESDAIYIVLNGRLRAIRDAENSAVKVIGEY
GQGDSVGELEVLTESARPGSLHAIRDTELAKFPKTLFNSLALEHPGITIKISKIIASRMR
ALIDDPLHEQSKERNTKATRANVSSTINLRTVTILPVTAGIPVVDFGSRLVNALTQIGLP
QGVVSLNQAAILNHLGRHAFNRMGKLKLSQYLADLEERYGMVIYVADTPVKSPWTQTCIN
QADCILLVGLAEASPNIGEYERFLLTTKTTARKELVLLHSERYCPSGLTRKWLRNRPWIN
GSHHHIQMSFRATSEPVHHAGRRFGNALKQRVQVIQAEIQKYTSRKVRQTPLYSADTPFK
GDFHRLARRLCGRSVGLVLGGGGARGISQIGIIRALEEAGIPIDIVGGTSIGSFIGALYA
WDADVVPMYGRAKKFAGRMGSMWRFALDLTYPSASYTTGHEFNRGIFKTFGNSQMEDFWL
EFYCNTTNISKSRSEIHTSGYVWRYVRASMSLAGLLPPLCDNGDMLLDGGYVDNLTVAHM
KSLGADVIFAVDVGSLDDNAPQAFGDSLSGFWATLNRWNPFSSFPNPPTLSEIQSRLAYV
SSIDALERAKNTPGCRYMRPPIDPYGTLDFAKFEEIYEVGYKYGKEYLAELREQGVLPVT
EETEKEKNLRRTMAPRRASI
NT seq 4563 nt NT seq  +upstreamnt  +downstreamnt
atggctactccgggaactgccacgtctcggtcgctcgcagatgtctccaaggcagctgtc
tataatactgcagaggctctgtcaaattctgtactcggcatgaagtcggccgataccacc
acgccttcgaccagctttggtctactgggccgcgttgttctgtccatcttcagtgtactg
cccaccatcctgtactgggtgacatacaccttgccaacatggttgttcacgctcttttct
atgagtctgacttttaccatgagcttcacatccttaatgctcgtggttgtgttcctagta
tcaaccattagttggttcgtaaggtaccgctacatgaccatgtacgcgcgacttccccca
gaaccccaacgtgaggaacctcaggtcgaggtcttccctgacagtgctgagagtgattcc
aagagggggctgtctaattatcttgatgaattcttgagcgcaatcaaggtgtttggttat
ttggaacgccccgtcttccacgaactcacacgcactatgcagactcgtcgcctagttgct
ggcgagacgatccttttggaggaagagaagggcttctgtctggttgtagatggcttggtc
cagatctttgtcaagtctaatcgggctgactctgattctgacgaagacgacatgggtggt
acagagtcgggtgattccgcacaacagggtcatgggcaaggctaccagcttctcactgaa
gtcaaaaacggcgcacccatgtcctcgttgttctccatactcgcattgttcacagaagac
gtcaaactgcgccatgacgaagacccagatacgggcccaagcataccgggaacacccaac
ggagcacaaagcagaccatcagtatcgcgaacgagcagctttgccctagataattcgaga
ccccaaagtccgcgagaggcacctgaagctagactacgacatcgaagaacgtcaaccttg
aacagccccacggcgggtgggcggcttgaaagagtaccgcccctctcgttggatctggaa
gaatttggcaatgaacgcctcaaaaacaccaagactagaaaatcgccttcacggcccggt
aaacccaaatctgctcacccagatattgttgcgcgggccaccgtagataccaccatcgcc
atcattccagcgactgcatttcgacgattaacacgcatataccccaaagcaacggcgcac
attgtccaggttattctcacacgcttgcaaagagtcactctcgcgacaagccatgcttat
ttaagcctaacgaatgaggtcctccgtacagagaagctcatgaacaaatacaccacgtac
gaccttccgggattccttcgtgacgctcctcttgagcgcttgaaggagaaatttgcaaag
gagacggagcgtatcggcgaagatgaaggcatgaaaggtattgcgctacataatccggga
gccggtcgtagacggagatctagtgtatcgctcagaagagggacagctgctcaagcccgt
cttgcggctgcgcgggaagcaagtgcgactggaactgtgggcagcgtcgccttaccgaag
atgacatcgccagaccagggtcctcgcaacgaccgaataagtgcaggggatctgttgacc
aactcacagatggcgcgaggagccggtcgcattggacgcagcagtttttcccaaccttat
caccaggatcgccgagatgtccgtacgccgctcgatgccagctcatttaatccgttcgcc
tccccgtcactacgtccaaagacactacataggcaagaatctattgatgaagctaccgta
ttccgagagtcgattctcggctgtatgttcaaggccattggactcaccaacttggaaacc
cctatgccaagagcaacagcatcagtagagcagtcaccacagcttgtctcttttgatgct
ggtcgacagaaggctgtatttacaaatgcattcggcttcattgatccatacgccgcttcc
agggatggagacactgaatccgtagcttcagcgtcaaatctgtcaggcatgggtggaatg
ggctcccacaacatcttggaagagattgtcagtgatgtggaaattgtctttttccctaaa
gattctgtccttgtggaacaaggtgaaaggaaccctggcttatattatgtgattgacgga
ttcctggacgtgagtgtccaggtggaagaagcctccgagaagaatgtattcggaactgct
ccaaatgggaatggatgtactgaagaggaactcttcggttctcccctaaaacccaccagt
tcaaatactggtggtaggcctcctgttgacggcagcaagaagaaacgcacaagacgaagt
ctcttcatgacgaaacctggcggactagctggatatctcgggacagtatcatctaatcgg
tcctttgtggacgtcacagccaagacagatgtttacgtcgggtttctgcctcgcgggtcc
atcgagaagatagtggagcgttatccggtcgtcttacttacaatggccaaacgactgaca
acgcttctgccacgtctaattcaacacatagatttcgccttggaatgggtccaggtcaat
gctggccaggtaatttacaaccagggtgacgagagtgacgcgatctatatcgttttgaac
ggaagattaagagccattcgcgacgctgaaaacagtgcggtcaaagtcattggcgaatat
ggccaaggtgatagtgtaggcgaactcgaggtgctaacggaatctgctcggcctgggtca
ctgcacgctattcgagatacagagctcgcaaagttcccaaagactttgtttaacagtctt
gctttggagcatccaggaattacaatcaagatctccaaaatcatagcctctcgtatgcga
gctctgattgacgatccgctacacgagcaaagcaaagaaagaaacacaaaagctacccgc
gccaatgtgtcgtcgactatcaatctccgcactgtgaccattctcccagtgacagctgga
atcccagtggtggactttggaagtcgtctagtgaatgcactcacgcaaatcggtctgccg
cagggcgtagtttccctaaaccaagccgccatcctcaaccatctcgggcgacatgcattc
aaccggatgggcaagctcaagctttcgcaatatcttgccgacctggaagaaagatatgga
atggtcatctatgtggccgatacgcccgtcaagtcaccgtggacacagacttgtatcaat
caagcagattgtatcctccttgtgggtctggctgaggcgtcacctaatattggcgagtac
gagcgcttcttgttgacgaccaagactactgcgcgcaaggaacttgtgcttctgcattcg
gaaagatactgcccttctgggctaacacgcaagtggctaagaaaccgtccgtggatcaat
ggcagtcatcatcatatccaaatgtcgttccgtgccacgtcagaaccagttcaccatgcc
ggacgacggtttggaaacgcgctcaagcaacgggtgcaggttatccaggctgaaatccag
aagtatacatcgaggaaagttcggcaaacgccactctactctgccgatacaccattcaag
ggtgatttccatcgacttgcaaggcggctatgcggcagatcagtcggcctcgtattggga
ggtggtggtgctcgcggtatatcgcaaatcggcatcatccgcgcactcgaggaagcaggg
attccgattgacattgttggaggcacatctattggcagttttataggtgcattgtacgct
tgggacgcagatgtggtacccatgtacggtagggcaaagaagtttgcagggcgcatgggt
agtatgtggagatttgcactcgacctcacgtacccatctgcttcatacacaaccggccac
gagttcaaccgcggtatcttcaagacgtttggaaattcgcagatggaagacttttggttg
gagttttattgcaataccaccaacatcagcaagtcgcggtcagagattcacacatcaggc
tatgtgtggcgctacgtacgtgcgtccatgtcactagccggcctacttcccccgctatgc
gacaatggcgacatgcttctcgacggaggctatgttgacaacttgactgttgcacacatg
aagagtcttggtgccgatgtcatttttgcagttgatgttggcagtctcgacgacaatgcg
ccgcaagcgtttggcgactcgttgagcggcttctgggcgacgctcaaccggtggaaccct
ttctccagctttccgaacccgccgacactatcggagatccaatctcgacttgcgtatgtg
tccagtatcgatgcgctggagcgggcaaagaacacgccgggatgcagatatatgcggccg
ccgattgatccatacggcacgctagattttgccaagtttgaagagatctacgaggttggc
tacaagtatggcaaagagtacctagcagaactccgcgaacaaggtgtgctccccgtgacg
gaagagacggagaaggaaaagaatctccgacggacaatggcaccgcgacgggcgagcatt
tga

DBGET integrated database retrieval system