KEGG   Pyrenophora teres: PTT_20031Help
Entry
PTT_20031         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
pte  Pyrenophora teres
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    PTT_20031
Enzymes [BR:pte01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     PTT_20031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 961 aa AA seqDB search
MSDSESEQHTARLEPELREMKLGPAHWEGAGEGDGASEVKVEDEAFLDHRVPASLAIPPR
LKSRSKSQSPRVKHDSEAPSPGSAHEETLAGDITLKMEPGKPPKLSRTASQKVVTRSPPL
YLDLPDSTEAAKETFVVLPECTYANKTIGTTDPALECDCQEEYDSATKTNHACGEDSDCI
NRATKMECVGDCSCGRRCQNQRFQRKQYADVTVIKTEKKGFGLRANKNMVPGDFVFEYIG
EVIDERTFRRRMGQYDEEGIKHFYFMSLTKGEFVDATKKGNLGRFCNHSCNPNCFVDKWV
VGDKLRMGIFVERNVRAGEELVFNYNVDRYGADPQPCYCGEPNCSGFIGGKTQSDNATKL
SGATIEALGIDDGAGWDTAVAKKPRKKKASEDDEEYVNDLQPRELEEDGVKKVMPALRNC
TEKWIAVKLLSRMQTNNERVGHRIVQFHGYNILKTALTTWKEDTNVVLQVLDILHRLPRI
TRNKIQDSKIEEAVEELTHYEDERVRESAEKLLKEWSKLEVAYRIPRMKRDPNAGTAART
ENHFERRERGRERSKSRSKSPSTIAPKGPSAAGAPSGPRVLNAPRGPAGFFVPPRPVMRP
RPFNTLPAGWFQASAENGSTYFYNSAGTTQWQRPTQPANTPPPPPNKARDNTQLLKDIIS
NITSNPTASGPSTSTTPQPVADEQMEKPSSRDKWRTLTIEKQEKVYEATIAPYIMSTANL
YSKKLEKEEFKSLCKEVAKKVVRGDYKNGPVKDPTAKIPPNHQKRIKNCVHEYMNKAVKT
AEERRRMKASRSSSSRANSKDATTPNTPQYHPKDHHHSHNHNHHHQHSGSSTPKAPNTTS
PTDSTHDLKRKRSSDDTASASASASTTASTTHSTSSPKRSRTASETLPSAPPPPPPPPET
TETEEASLTPMYDSPGTISKAVPFQQQPDDYASPMQLATPPTNGMAHGHSDGRGGSGGSR
D
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatagcgagtcggaacagcacaccgctcggctcgagcccgagctacgcgagatg
aagttggggcccgcgcactgggaaggagcaggtgagggtgatggtgcaagtgaggtaaag
gtcgaggacgaagcttttcttgaccaccgcgtgcccgcctccctcgccataccgcccagg
ctcaagtcgcgctcaaagtctcagtcgccccgcgtcaagcacgactcggaagccccatcg
cccggcagcgcccatgaagagacgttggcgggagatatcacgctgaagatggaacccggc
aagccacccaagctctcgcgcaccgcgtcccaaaaagtcgtcacacgctcgccgccgcta
tatctcgaccttcccgactctaccgaagccgccaaagagacttttgtcgtcctcccagaa
tgcacctacgcgaacaagacgattggaacgaccgaccctgccctcgaatgcgactgccaa
gaagaatacgactcggccacaaagaccaaccatgcttgtggtgaggactccgactgcatc
aaccgcgccaccaaaatggaatgtgtgggggattgcagctgcggcaggaggtgtcagaac
cagcgcttccaacggaaacagtatgccgatgtcaccgtcatcaagaccgagaagaagggc
tttggcctgcgtgccaacaaaaacatggtgcccggtgactttgtctttgagtacattggc
gaggtcatcgacgagcgcaccttccgtcgccgcatgggtcaatacgacgaggaaggaatc
aagcacttttacttcatgtccctcacaaagggcgagttcgtagatgccacaaagaagggt
aacttgggacgtttctgcaatcactcgtgtaaccccaactgtttcgtcgacaaatgggtt
gttggtgacaagctgcgtatgggcatctttgtcgagcgcaatgtaagggcaggtgaggag
ctcgtcttcaactacaacgttgaccgctacggcgctgatccacaaccctgctactgtggt
gagcccaactgcagtggcttcatcggcgggaagacccaatctgacaatgcgacaaaactt
tctggtgctaccatcgaggccctcggtattgatgatggcgctggctgggacactgccgtt
gccaagaaaccccgcaagaagaaggctagcgaagacgacgaggagtatgtcaacgacttg
cagccacgagagcttgaggaagacggggtcaagaaggtcatgccggctctgcgcaattgc
actgagaagtggattgctgtcaaactgctcagtcgtatgcaaaccaataatgaaagggtc
ggccaccgcattgttcagtttcacggctacaacatcttgaagacagccctgactacttgg
aaagaggacaccaacgtcgttctacaagtgcttgacatccttcaccgactaccgcgcatt
acccgaaacaagattcaagactccaagattgaagaggccgtcgaggaactgacgcactac
gaagatgagcgcgtacgcgagtcggctgaaaagctgctgaaggaatggagtaagctggag
gtggcatacaggatacctcgtatgaagagagatccgaatgctggcaccgctgcccgtact
gagaatcattttgagcgccgtgagagagggcgggagcgatcaaaatctagatcaaaatca
ccgtctacaatcgcgcccaaaggaccatcagcagcaggcgcgccgtctggtccacgcgta
ttaaatgcaccccgtggcccagccggcttctttgttcctccacgaccagtcatgcgaccc
cgaccgttcaacaccctacctgctggttggtttcaagcatcagcagaaaatggctctaca
tatttttacaactccgccggcactactcaatggcaacgtccgacccagcctgccaacact
ccgccacctccaccaaacaaggccagagacaatacacagttgttaaaagacataatatcg
aacatcacctcgaatccaaccgcgtctgggccttccacgtcgacgacacctcagccagtt
gccgatgagcaaatggagaagccatccagtagggacaagtggcgaaccctaacgatcgaa
aaacaggaaaaggtgtatgaggcgacaattgcaccctacattatgtctaccgccaatctt
tactccaagaagctcgaaaaggaagagttcaagagcctatgcaaagaggtagcaaaaaag
gtcgtacgcggcgactacaaaaacggccctgtcaaagaccctacggccaagattccaccc
aaccatcaaaaacgcatcaaaaactgcgtccacgaatacatgaacaaggccgtcaaaacc
gccgaagagcggagaagaatgaaggcctcccgaagcagctcttcgagagcgaactcaaaa
gacgctacaacaccaaataccccacaataccatcccaaagaccaccaccatagccataac
cacaaccatcaccatcaacattccggctcctcaaccccaaaagcaccaaacacaacctcg
cccacagactcaacccacgacctcaaacgcaagcgctcctcagacgacaccgcctccgcc
tccgcctccgcctccacgacagcatcaaccacacactcgacctcctcccctaagcgcagc
cgtacagcctcagaaaccctcccttctgcgcctccgccgccgccgcctccaccagagaca
acagagacagaagaagccagtttgacgcccatgtacgacagcccgggtacaatatcaaaa
gctgtgccgttccagcagcagccagacgactacgctagtcccatgcaacttgccacgccg
cctacgaatggcatggctcatgggcatagtgatgggcgcggaggtagcggcgggtcgaga
gattga

DBGET integrated database retrieval system