KEGG   Pyrenophora teres: PTT_20305Help
Entry
PTT_20305         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
pte  Pyrenophora teres
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:pte00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PTT_20305
   03420 Nucleotide excision repair
    PTT_20305
   03430 Mismatch repair
    PTT_20305
   03440 Homologous recombination
    PTT_20305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 288 aa AA seqDB search
MRQAHYNGYETSYTSYGAGGGAGGGGFIPGEGGNTQSPGNRRDHSQDSLRPVTIKQILEA
QGEAGSSSDQILKIDGAVLSQLTLVGQIRNISNQTTNNTYRLDDGTGSIEVKVWVDSDSS
EQPNPTKAKLVEGAYCRAWGKLKIFNDRRSVGATVIRPIEDMNEISFHLLEATAVHLHFT
RGPPGGAQTAGANANGAVGQQQQQQQQQQAAGGNYGGYDLTAYGQVAKKVFQYLREAPQS
NEGLNQHEIAAKLGIDTADVAKAGDELLSGGLIYTTVDDQTWAILEAD
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaggcgcactacaacggctacgaaacctcgtatacctcgtacggcgccggcggt
ggtgctggcggaggcggcttcataccaggagaaggcggcaatacacaaagccctggcaac
cgacgagaccactctcaagactcgctgcgcccagtcaccatcaagcaaatccttgaggcc
caaggagaagccggtagcagtagcgaccagattctcaagatcgatggcgccgtactcagt
cagctcacacttgtcggccaaatacgcaacatatccaaccagaccacaaacaatacgtac
agactcgatgacggcaccggaagtatagaggtcaaggtctgggtcgattccgactcttct
gaacagcccaacccaaccaaagccaagcttgttgaaggtgcatactgcagagcatggggc
aaattaaagattttcaatgaccggagatctgtgggagcgaccgtcatccgcccaatcgaa
gacatgaacgagatttcattccacctgctcgaagcgaccgctgtacatttacacttcact
cgcgggccacctggtggtgcgcagactgctggtgccaacgcaaatggtgcggtaggacag
cagcaacaacaacaacaacaacaacaagcagccggtggtaactatggcggctacgatctc
accgcttacggccaggtagcaaagaaggtgttccagtatttgagggaagcaccgcagtcg
aacgagggtctgaatcagcatgagattgctgcaaagctcggtatcgatacggccgatgtt
gcaaaggccggcgacgagcttctgtctggaggtctcatctataccaccgtcgacgatcag
acctgggcaatcctcgaggccgattaa

DBGET integrated database retrieval system