KEGG   Panthera tigris altaica (Amur tiger): 102948685Help
Entry
102948685         CDS       T02988                                 

Gene name
PTGS2
Definition
prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
Orthology
K11987  
prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
Arachidonic acid metabolism
Metabolic pathways
NF-kappa B signaling pathway
VEGF signaling pathway
TNF signaling pathway
Retrograde endocannabinoid signaling
Serotonergic synapse
Ovarian steroidogenesis
Oxytocin signaling pathway
Leishmaniasis
Pathways in cancer
Chemical carcinogenesis
MicroRNAs in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102948685 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    102948685 (PTGS2)
   04064 NF-kappa B signaling pathway
    102948685 (PTGS2)
   04668 TNF signaling pathway
    102948685 (PTGS2)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    102948685 (PTGS2)
   04921 Oxytocin signaling pathway
    102948685 (PTGS2)
  Nervous system
   04726 Serotonergic synapse
    102948685 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    102948685 (PTGS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102948685 (PTGS2)
   05206 MicroRNAs in cancer
    102948685 (PTGS2)
   05204 Chemical carcinogenesis
    102948685 (PTGS2)
   05222 Small cell lung cancer
    102948685 (PTGS2)
  Infectious diseases
   05140 Leishmaniasis
    102948685 (PTGS2)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102948685 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 604 aa AA seqDB search
MLARALLLCAALALCRAANPCCSNPCQNQGVCLSIGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGVWNIVNNIPFLQNIIMKYVLTSRSHLIESPPTYNVDY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLSHVYGETLDRQHKLRLFKDGKMKY
QIIDGEVYPPTVKDTQVEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTLQIDDQEYNFQQFVYNNSILLEHGLTQFVESFSRQIAGRV
AGGRNVPAAVQQVAKASIDQSRQMKYQSLNEYRKRFRLKPYTSFEELTGEKEMAAGLEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVEMGAPFSLKGLMGNPICSPDYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTAFSVQDPQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcccgcgccctgctgctctgcgccgccctggcgctctgccgtgcagcaaatcct
tgctgttccaacccatgccaaaaccaaggtgtatgtctgagcataggatttgaccagtat
aagtgtgactgtacccgaacaggattctatggtgaaaactgttcaacacctgaatttctg
acaagaataaagttattcctgaaacccactccaaatacagtgcactacatacttacccac
ttcaagggagtctggaacattgtcaataacattcccttcctgcaaaatataattatgaaa
tatgtgttgacatccaggtcacatttgattgagagcccaccaacttacaatgtggactat
ggctataaaagctgggaagccttttccaatctctcctattataccagagctcttccccct
gtggctgatgactgcccaacacccatgggtgtgaaaggcaagaaagagcttcctgattca
aaagagattgtggaaaaatttcttctaagaagaaagttcattcctgacccccaaggcaca
aatatgatgtttgcattttttgcccaacacttcacccatcaatttttcaagacagatcat
aagcgaggaccagctttcaccaaaggactgggccatggggtggacttaagtcatgtttat
ggcgaaactttggatagacagcataaactgcgccttttcaaggatggaaaaatgaaatac
cagataatcgatggggaggtgtatcctcccacagtcaaagatactcaggtcgagatgatc
tacccacctcacgttcctgaacacctgcggtttgctgtgggccaggaggtctttggtctg
gtgcctggtctgatgatgtacgccacaatttggctgcgggaacacaacagagtgtgtgat
gtgcttaaacaggagcatccagaatgggatgatgagcggttgttccagacgagcaggcta
atactgataggagaaaccattaagattgtgattgaagactatgtacaacacttgagtggc
tatcacttcaaactgaagtttgacccagagctgcttttcaaccaacaattccaataccaa
aaccgtattgctgctgagtttaacacactctaccactggcatccccttctgcctgacacc
ttgcaaatagatgaccaggagtacaatttccagcagtttgtctacaacaactctatatta
ctggaacatgggcttacccagttcgtggaatcattcagcaggcaaattgctggcagggtt
gctggtggtaggaatgttccagctgcagtgcagcaagtagcaaaggcctcaatcgaccag
agcagacagatgaagtaccagtctcttaatgagtatcgcaaacgctttcggctgaagccc
tatacatcgtttgaagaactcacaggagagaaggaaatggctgcggggttagaagcactt
tatggtgatattgatgccatggagctgtatcctgcccttctggtagaaaagcctcgccct
gatgccatctttggtgagaccatggtagaaatgggagcaccattctccttgaaagggctt
atgggtaatcctatatgctctcctgactactggaagcctagcacttttggtggagaagta
ggttttaaaatcatcaacactgcctcgattcagtctctcatctgcaataacgtgaagggc
tgtccttttactgcattcagtgttcaagatccacagctcaccaaaacagtcaccattaat
gcaagctcttcgcactctggactggatgatatcaatcccacagtactgctaaaagaacgt
tcaactgaactgtag

DBGET integrated database retrieval system