KEGG   Panthera tigris altaica (Amur tiger): 102949487Help
Entry
102949487         CDS       T02988                                 

Gene name
UCHL1
Definition
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    102949487 (UCHL1)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102949487 (UCHL1)
Peptidases [BR:ptg01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102949487 (UCHL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 237 aa AA seqDB search
MQLKPMEINPEMLNKVNGVSRRLCPHPPEAPTGPGCLAGWRFADVLGLEEEALGSVPAPA
CALLLLFPLTAQHENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKL
EFEDGSVLKQFLSETEKLSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFN
NVDGHLYELDGRMPFPVNHGTSSEDSLLQDAAKVCREFTEREQGEVRFSAVALCKAA
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcaaaccgatggagattaaccccgagatgctgaacaaagtgaatggcgtctcg
cgccgcctctgtccccatcccccggaggcgcccaccggccccggctgtctcgcagggtgg
cgcttcgcagacgtgctggggctggaggaggaggctctgggctcggtgcccgcgcccgcc
tgcgcgctgctgctgctgtttcccctcacggcccagcatgagaacttcaggaaaaaacag
attgaagaactgaagggacaagaagtcagtcccaaggtgtacttcatgaagcagaccatc
gggaactcctgtggtaccatcggactgatacatgcagtggccaataaccaggacaaactg
gagtttgaggatgggtcagtcctgaaacagtttctttctgaaacggagaagctgtcccct
gaagacagagcaaaatgctttgagaagaatgaggccattcaggcagcccatgatgccgtg
gcccaggaaggccaatgtcgggtagatgacaaagtgaattttcattttattctgtttaac
aacgtggatggccacctctatgaacttgatggacgaatgccttttccggtgaaccatggc
accagctcagaggactcattgctgcaggatgccgcgaaggtctgcagagaattcactgag
cgtgagcaaggggaggtccgcttttctgctgtggcactctgcaaggcagcctga

DBGET integrated database retrieval system