KEGG   Panthera tigris altaica (Amur tiger): 102951344Help
Entry
102951344         CDS       T02988                                 

Gene name
PCSK2
Definition
proprotein convertase subtilisin/kexin type 2
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     102951344 (PCSK2)
Peptidases [BR:ptg01002]
 Serine Peptidases
  Family S8: subtilisin family
   102951344 (PCSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 638 aa AA seqDB search
MKGGCVSQWKAAAGLLFCVMVFASAERPVFTNHFLVELHKGGEEEARQVAAEHGFGVRKL
PFTDGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDIN
MNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASN
YNAEASYDFSGNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRM
LDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK
GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK
RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDIQHLTVLTSKRN
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIP
STGKLVLTLTTDACEGKENFVRYLEHVQAVITVNASRRGDLNINMTSPMGTKSILLSRRP
RDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSTPQKGVLKEWTLMLHGTQSAPYI
DQVVRDYQSKLAMSKKEELEEELDEAVERSLKSILREN
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtggctgtgtctcccagtggaaggcggccgccgggctcctcttctgtgtcatg
gtttttgcatctgccgagagaccggtcttcacgaatcattttcttgtggagttgcataaa
ggaggagaggaagaagctcgccaagttgcagcagaacacggctttggagtccgaaagctc
cccttcactgacggcctataccacttttaccacaatggccttgcaaaggccaagagaaga
cgcagcctacatcacaagcagcagctggagagagaccccagggtaaagatggccttgcag
caggaaggatttgacagaaagaagcgggggtatagagacatcaatgagattgacatcaac
atgaatgatcctctttttacaaagcagtggtatctgatcaacacagggcaagccgatggc
actcctggtcttgatttgaatgtggcagaagcttgggagctgggatacacagggaaaggt
gtcaccattggaattatggatgatgggattgactacctgcacccggacctggcctcgaac
tataacgccgaagcgagctatgacttcagcggcaatgacccctacccctaccctcgatac
acagacgactggttcaacagccatgggacccgatgtgcaggggaggtttctgccgcggcc
aacaacaatatctgtggggtcggagtggcatacaactccaaggttgcaggtatccggatg
ctagaccagccattcatgacagacatcattgaggcctcttccatcagccacatgcctcag
ctgatcgacatctacagtgccagctggggcccgacagacaacgggaagacagtggatgga
ccccgggagctcacgcttcaggccatggccgatggcgtcaacaagggtcgaggcggcaaa
ggcagcatctacgtgtgggcctccggggacggcggcagctacgacgactgtaattgtgat
ggctacgcctccagcatgtggaccatctccatcaactcggccatcaacgacggcagaacc
gccctgtacgacgagagctgctcctccaccttggcctccaccttcagcaacgggaggaag
aggaaccctgaggccggcgtggcaaccacagatttgtatggcaactgcactctgaggcat
tctgggacatccgcggctgcccccgaggcagctggagtgtttgcactggctttagaggct
aacttgggtctgacctggagagacatacagcatctgactgtgcttacctccaaacggaac
cagcttcacgacgaggtccatcaatggcggaggaatggggttggcctggagtttaatcac
ctctttggctacggggtccttgatgcaggcgccatggtgaaaatggctaaagactggaaa
actgtgcccgagagattccactgtgtaggaggctccgtgcaggaccctgagaaaataccc
tccactggcaagttggtgctgaccctcacgaccgacgcatgtgaggggaaagagaacttc
gtccgctaccttgagcacgtccaagctgtcatcacggtcaatgcaagcaggagaggagac
ctgaacatcaacatgacctccccaatgggcaccaagtccatcttgctgagccggcgtccg
cgggatgacgactccaaggtgggctttgacaagtggcctttcatgaccacccacacgtgg
ggggaagacgctcgaggaacctggaccctggagctggggtttgtcgggagcaccccccag
aagggggtgctgaaggagtggacactgatgctgcatggcacgcagagcgccccttacatt
gaccaggtagtgagggattaccagtccaagctggccatgtccaagaaggaggagctggag
gaggagctggatgaagccgtggagagaagtctgaagagcatcctgcgcgagaactag

DBGET integrated database retrieval system