KEGG   Panthera tigris altaica (Amur tiger): 102958733Help
Entry
102958733         CDS       T02988                                 

Gene name
SPACA5
Definition
(RefSeq) sperm acrosome associated 5
  KO
K01185  
lysozyme [EC:3.2.1.17]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102958733 (SPACA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 160 aa AA seqDB search
MKGFVTAKVTLAMLMAAIVDAKIYERCELALKLERAGLNSFKGYTVGDWMCMAHYESGFD
TSFVDHNPDGSSEYGIFQLNSAWWCDNGITPTQNLCHMDCHDLLNRHLLDDILCARQVVS
SQNGMTAWDSWIRHCYGHDLSEWLKGCNMHAKHDSKKINS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaagggttttgttactgcgaaggtcaccttagccatgcttatggctgctattgtggat
gccaagatctatgaacgctgtgaactggcactgaagctggagagggcaggcctcaacagc
ttcaagggctacaccgttggagactggatgtgcatggcacactatgagagtggttttgac
acttccttcgtggaccacaatcctgacggcagcagtgaatacggcattttccagctgaac
tctgcctggtggtgtgacaatgggattacacccacccagaacctctgtcacatggattgt
catgacctgctcaaccgccatcttctagatgatatcttgtgtgccaggcaggtggtgtcc
tcacagaatggtatgactgcttgggattcttggatccggcactgctacgggcatgattta
tctgaatggctcaagggatgtaatatgcatgcaaaacatgactcaaagaaaattaattca
tga

DBGET integrated database retrieval system