KEGG   Panthera tigris altaica (Amur tiger): 102959975Help
Entry
102959975         CDS       T02988                                 

Gene name
COMT
Definition
(RefSeq) catechol-O-methyltransferase
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00140  Steroid hormone biosynthesis
ptg00350  Tyrosine metabolism
ptg01100  Metabolic pathways
ptg04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102959975 (COMT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    102959975 (COMT)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    102959975 (COMT)
Enzymes [BR:ptg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     102959975 (COMT)
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   102959975 (COMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 CmcI Methyltransf_31 CMAS PCMT
Motif
Other DBs
NCBI-GeneID: 102959975
NCBI-ProteinID: XP_007091488
Position
Un
AA seq 268 aa AA seqDB search
MLEAPPLLLAAFSLGLVLLVLLLCHSYSGFLLICWNEFVLQPLYNLFMGDTKEQRILRHV
LQHAVAGDPQSVLEAIDTYCLQKEWAMNVGDKKGQILDAVVREQRPSVLLELGAYCGYSA
VRMARLLEPGARLLTIELNPDYAAITQQMLDFAGLQDRVTVVAGPSQDIIPQLKKKYDVD
MLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGTPEFLAYVRNSSRFECTH
FTSYLEYSTAVDGLEKAVYVGQDGPAQP
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgctggaggccccacccctgctgttggcagccttctcattgggcctggtgctgctggtg
ctactgctgtgccactcctactcgggctttctccttatctgctggaatgagttcgtcctg
cagcccctctacaacctgttcatgggcgacaccaaggagcagcgcatcctgcgtcatgtg
ctgcagcatgcggtggccggggacccacaaagtgtgctggaggccatcgatacctactgt
ttacagaaggagtgggctatgaatgtgggtgacaagaaaggccagatcttggatgcagtg
gtgcgggagcagcgcccatcggtgctgctagagctgggggcctactgcggctactcagcc
gtgcgcatggcccgcctgctggagcccggggcccgactgctcaccattgagctcaaccct
gactacgccgccatcacccagcagatgctggactttgcaggcctgcaggacagggtaacc
gttgtggccgggccatcccaggacatcatcccccagctaaagaagaaatacgatgtggac
atgctagacatggtcttccttgaccactggaaggaccgatacctgccagacactcttctc
ctggaggagtgtggcctgctacggaaggggacagtgttgctggccgacaacgtcatctgc
ccaggaacaccagaattcctggcatatgtgcgcaacagcagccgctttgagtgcacacac
ttcacctcgtacctggagtactcgacagcagtggatggcctcgagaaggctgtctacgtg
ggccaggatggcccagcacagccttga

DBGET integrated database retrieval system