KEGG   Panthera tigris altaica (Amur tiger): 102960215Help
Entry
102960215         CDS       T02988                                 

Gene name
SRD5A3
Definition
(RefSeq) steroid 5 alpha-reductase 3
  KO
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102960215 (SRD5A3)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     102960215 (SRD5A3)
    1.3.1.94  polyprenol reductase
     102960215 (SRD5A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 279 aa AA seqDB search
MPRGPVDSKDGEPRGNVSLEPHESFPGGKWQRFRWYFSHFYIISVLWNGFLLWQLTQSLF
LGVPFPYWLHGLLRILGAAQFQGSELALSAFLVLVFLWLHSLRRLFECFYVSVFSNAVIH
VVQYCFGLVYYVLIGLTVLSQVPMDGRNVYVIGKNLLMQARWFHILGMMMFIWSSVHQYK
CHVILGNLRKNKAGVVIHCNHRIPFGDWFEYVSSPNYLAELMIYISMAVTFGFHNLTWWL
VVTYVFFSQALSALLSHKFYKSKFVSYPKHRKAFLPFLF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgccccgagggccggtggacagcaaagatggtgagccgcgcggcaatgtgagcttggag
ccgcacgagtctttccctggggggaaatggcagcgcttccgatggtatttttctcacttc
tatatcatctcagtgctgtggaatggcttcctgctttggcaacttactcagtctctgttc
ctgggagtgccttttccatactggctgcatggtttgctcagaattctcggggctgcccag
ttccaagggagtgagttggcgctgtctgcattcttagtgttagtatttctgtggctccac
agcctgagaaggctcttcgagtgcttctatgtcagtgtcttctccaatgctgtgattcac
gttgtgcagtactgttttggactcgtctactatgtcctcatcggcctaactgtgctgagc
caagtgccaatggacggcagaaatgtctatgtgatagggaaaaatctcttgatgcaagcc
cggtggttccatatcctcggaatgatgatgtttatctggtcatctgtccatcagtacaag
tgccatgtcattctcggcaatctcaggaaaaataaagcaggagtggtcattcactgtaac
caccgaatccctttcggagactggtttgaatacgtttcttcccctaactacttagcagag
ctgatgatctacatttccatggctgtcacctttggattccacaacttaacttggtggcta
gtggtgacatatgttttcttcagccaggccctgtctgctttgctcagtcacaaattctac
aaaagcaaatttgtctcctatccaaagcataggaaagctttcctaccatttctgttttaa

DBGET integrated database retrieval system