KEGG   Panthera tigris altaica (Amur tiger): 102961078Help
Entry
102961078         CDS       T02988                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    102961078 (DBH)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     102961078 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 520 aa AA seqDB search
MHPVPSGPTPPAVHPLLLEQPRHQLEPSVYFQLLVQELKAGVLFGMSDRGELENADLVVL
WTDGHGTYFGDAWSDQRGQIHLDSRQDYQLLRARRTPKGLSLIFKRPFDTCDPKDYLIED
GTVHLVYGVLEEPFRTLEAVNTSGLQTGLQRVQLLKPSIPIPALPADTHTMEIRTPDILI
PDQPTTYWCHITELPDGFSRHHIVMAFYYPEEAGLAFGGAESSRFLRLEVHYHNPLKIQD
GQAKKKYSVRDHRPPGERRASGAAGRETRGPASKRRLPVVTGVAALPPSGIHIFASQLHT
HLTGRKVVTVLVRDGREREIVNRDDHYSTHFQEIRMLKKMVSVRPGDVLVTSCTYNTEDR
ELATVGGFGILEEMCVNYIHYYPQTQLELCKSTVDPGFLREYFHLVNRXQFHGSSGMTGG
GEAPPCKGGPREGGLEHTQAQEDPFPLSTMTASGDKGPGQPGAVGEGARRTRRPRRASLT
PTGPFLATITFFLSPQPPTQRLQPPNLPRGETPHPGSPAD
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcaccccgtgccatctggccccacccccccagcagtacacccactcctgctggagcag
cccaggcaccagctggagcctagcgtctacttccaactcctggtgcaggagctcaaggcc
ggtgtcctgtttgggatgtcggaccgcggcgagttggaaaatgctgacctggtggtgctc
tggaccgacggacacggcacctactttggggatgcctggagtgaccagaggggacagatc
cacctggattcccggcaggattaccagctgctgagggcacggagaaccccgaaaggcctg
agcctgatcttcaagaggccctttgacacctgtgaccccaaggattacctcattgaggat
ggcaccgtccacctggtttacggggtcctggaggagccgttccggacgctggaggccgtc
aacacctcggggctgcagacggggctgcagagggtacagctgttaaagcccagtatcccc
atcccggccttgcccgcggacacgcacaccatggagatccgcaccccggacatcctgatc
cccgaccagccgaccacatactggtgccacatcactgagcttccggacggcttctcccgg
caccacatcgtcatggccttttactacccggaggaagcaggccttgcctttgggggcgcc
gagtcctccagatttctccgtctggaagttcactaccacaacccgctgaagatccaagat
ggacaagccaagaaaaagtatagcgttcgagaccacaggcccccgggcgagcgacgagcc
tctggggccgcggggagagaaacccggggtcccgcaagcaagcggaggctgccagtcgtc
acaggcgtggccgccctgcctccctcagggatccacatcttcgcctcccagctccacaca
cacctgacggggaggaaggtggtcactgtgctggtccgggacggccgagagagggagatt
gtgaacagggacgaccactacagcactcacttccaggagatccgcatgttgaagaagatg
gtgtccgtgcgcccgggggacgtgctcgtcacttcctgtacgtacaacacagaagacagg
gagctggccaccgtggggggcttcggtatcctggaggagatgtgcgtcaactacatccac
tactacccccagacgcagctggagctctgcaagagcaccgtggacccgggtttcctgcgg
gagtatttccacctggtgaacaggtgacagttccacgggagttctgggatgacaggtgga
ggggaggcccctccctgcaagggcgggcctcgggaaggtggcctggagcacacccaggcc
caagaagaccccttccctctgagcacgatgactgccagcggggacaagggtcctggccag
cccggggctgtgggagagggtgccaggaggacccgcagaccacggcgagccagcctcacc
cccactgggcccttcctggccaccatcactttcttcctgagcccccagcccccaacacag
cgcttgcagcctcccaatctccccagaggagaaacgcctcacccagggtccccggcggat
tag

DBGET integrated database retrieval system