KEGG   Panthera tigris altaica (Amur tiger): 102961717Help
Entry
102961717         CDS       T02988                                 

Gene name
JOSD2
Definition
(RefSeq) Josephin domain containing 2
  KO
K15235  
josephin [EC:3.4.19.12]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102961717 (JOSD2)
Peptidases [BR:ptg01002]
 Cysteine Peptidases
  Family C86
   102961717 (JOSD2)
Ubiquitin system [BR:ptg04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    102961717 (JOSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 221 aa AA seqDB search
MALQLRVLGAAVDFRAKLPGSCVRGKGPSRGPPEAVVGRRGEGRCQATGERRGWGAEDGM
SQAPGAQPSRPSVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRS
LRGTGNYDVNVIMAALQGLGLATVWWDRRRWDPKRFTTCAEPGTWVRWDSRRGTGGQEGR
KKGQTGGRSARVGAGQRAGRRAGRWSSGDRVDGKRVVGRVE
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcattgcagctccgcgttctcggggcggcagtggacttccgggccaagctgcccgga
agttgcgtgaggggcaaagggccttcgcgggggccgccggaagctgtagtcggcaggcgg
ggtgaggggcgttgccaggcaacgggcgagcgccgtggttggggagccgaggacggtatg
tcccaggccccaggagcacagccgagccggccctccgtttatcacgagcggcaacgcctg
gagctgtgtgccgtccacgccctcaacaacgttctgcagcagcagctctttagccaggag
gctgccgacgagatctgcaagaggttggccccggactcccggctgaatccccatcgcagc
ctccggggcaccggcaactatgacgtcaacgtgatcatggccgccctgcaggggctgggc
ctggccaccgtgtggtgggaccgaaggaggtgggaccccaagcgcttcaccacctgtgct
gagcctggcacatgggtgcggtgggacagcaggaggggaaccggtgggcaggagggaaga
aagaaggggcagacggggggaaggtcggcacgggtgggtgctggacagagggcaggccga
cgggctgggagatggtcatccggtgaccgagtggatggtaaaagggtagttggacgtgtt
gagtag

DBGET integrated database retrieval system