KEGG   Panthera tigris altaica (Amur tiger): 102963634Help
Entry
102963634         CDS       T02988                                 

Gene name
TGM1
Definition
transglutaminase 1
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
Enzymes [BR:ptg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102963634 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 820 aa AA seqDB search
MMDGPRSDVGRWGGNPWQPPTTPSPEPEPEPDRRSRRGGRSFWARCCGCCSCRNETDADW
GPEPHGDRGSGRGRGSSSGGRRPDSRGSDSRRPGSRASGVNAAGDGTIREGMLVVTGVDL
LSSRSDQNRREHHTDEFEYDELILRRGQPFDMVLHLSRPYESSDHVALELLIGNSPEVGK
GTHVIIPVGKGGSGGWKAQVTKASGQNLDLRVHTSPNAIIGKFQFTVRTRSEAGEFQLPF
DPHNEIYILFNPWCPEDIVYVEHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGV
LDACLYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVG
SVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYF
DENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFGGWQVVDATPQETSSGIFCCGPCSV
ESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIITKAIGSNMR
DDVTHIYKHPEGSEAERKAVETAASHGSKPNVYSTRDSAEDVAMQVEAQDAVMGQDLTVC
VVLTNRSSSRRTVKLHLYLSVTFYTGVTGSVFKESKKEVVLAPGASDRVSMPVAYKEYQP
HLVDQGSMLLNVSGHVKENGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPL
PITLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLHQKFVPVRPGPRQLIASLDSPQLSQ
VHGVIQVDVAPAPGSGGFFSDAGGDSHSGETIPMASRGGA
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgatggacggtcctcgttcagatgtgggccgctggggcgggaacccttggcagcccccc
accacaccttctccggagccggagccggagccggacagacgatctcgtcgaggaggccgt
tccttctgggctcgctgctgcggctgctgctcatgccgaaatgaaacagatgctgactgg
ggacctgagccccacggagaccgagggtctggcaggggtcgagggtccagctctgggggt
cgaagaccagactcccggggctcagattcccgccggcctggctcccgggccagtggtgtg
aacgcagctggagacggcaccatcagagagggcatgctggtggtgaccggtgtggatctg
ctgagttcacgctcggaccagaatcgccgagagcaccacacagatgagtttgagtacgac
gagctgattttacgccgtgggcagcctttcgacatggtcctccacctctctcggccctat
gagtcctctgatcatgttgccctggagctgcttatcggaaacagccccgaggtggggaag
ggcacgcacgtgatcatcccagtggggaaggggggcagcggaggctggaaagcccaggtg
accaaggccagtgggcagaatctagacctacgtgtccacacctcccccaacgccatcatc
ggcaagtttcaattcacggtccgcacacgttcagaggctggcgagttccagttgcctttt
gacccccacaacgagatctacatcctcttcaatccatggtgtccagaggacatcgtgtac
gtggagcatgaggattggcgacaggagtacgtgcttaatgaatccgggagaatttactat
gggactgaagcgcagattggcgagcggacctggaactatgggcagtttgaccatggagtg
ctggatgcctgcctgtacatcctagacaggcggggcatgccatatggaggccgcggggac
ccggtcagtgtctcccgggtcatctctgccatggtgaactccttggatgacaatggggtc
ctgattggaaactggtctggtgattactcccgaggcaccaacccatcagcttgggtgggc
agcgtggagatcctactcagctacctacgcaccggctattccgtcccctatggccagtgc
tgggtcttcgccggtgtgaccacaacagtgctgcgttgcttgggcctggctacccgcact
gtcaccaatttcaactcggcacatgacacagacacatccctcaccatggacatctacttt
gacgagaatatgaagcctctcgagcacctgaaccatgattctgtttggaacttccacgtg
tggaacgactgctggatgaagaggccagatctgccctctggctttggtgggtggcaggtg
gtggatgccacaccccaggaaaccagcagcggcatcttctgctgcggcccctgctctgtg
gagtccatcaagaatggcctggtatacatgaaatacgacacgcccttcatttttgccgag
gttaacagtgacaaagtttactggcagcgacaggatgatggcagctttaagatcgtgtat
gtggaagagaaggccattggtacgctcatcataacaaaggccattggatccaacatgcga
gatgatgtcacccacatttataaacacccagaaggctcggaagcagagcggaaggcagtg
gagacagcagcctcccacggcagcaaacccaacgtgtactccacgcgtgactcagcagag
gatgtggcgatgcaggtggaggcacaggacgcggtgatggggcaggacctgactgtctgc
gtggtgctgaccaatcgcagcagcagccgccgcaccgtgaagctgcacctctacctctca
gtcaccttctacaccggtgtcaccgggtctgtcttcaaggagagcaagaaagaagtggtg
ctggcgccaggggcctcggaccgcgtgtccatgcccgtggcctacaaggaataccagccc
cacctcgtagatcaggggtccatgctgctcaatgtctcgggccacgtcaaggagaacggg
caggtgctggccaagcagcacaccttccgtctgcgcacccctgacctttccctcactttg
ttgggggcagccgtggttggtcaggagtgcgaagtacagattgtcttcaagaacccgctg
cctataaccctcaccaatgtcgtcttccggcttgagggctccgggctacagagacccaag
atcctcaatgtgggggacattgggggcaacgagacagtgacgctgcaccagaagtttgtg
cctgtgcgaccaggcccccgccagctcatcgccagcttggacagcccccagctctcccag
gtgcatggtgtcatccaggtggacgtggctccggcccctgggagcggaggcttcttctca
gatgctggaggcgacagtcactcaggggagaccatccctatggcatctcgaggtggagct
taa

DBGET integrated database retrieval system